KEGG   Methanohalophilus mahii: Mmah_0127Help
Entry
Mmah_0127         CDS       T01211                                 

Definition
3-isopropylmalate dehydratase, small subunit (EC:4.2.1.33)
Orthology
K16793  
methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
mmh  Methanohalophilus mahii
Pathway
Lysine biosynthesis
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Mmah_0127
   01230 Biosynthesis of amino acids
    Mmah_0127
  Energy metabolism
   00680 Methane metabolism
    Mmah_0127
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mmah_0127
Enzymes [BR:mmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Mmah_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
157101..157583
Genome map
AA seq 160 aa AA seqDB search
MIKGKAWIFGDDVDTDVIIPGKYLRTTDMQVFADHAMEGIDPDFSSKVSPGDIIVGGNNF
GCGSSREQAPLALKHAGVGCVVARSFGRIFFRNSINVGLPLIEADVECEEGDEVEVNLSE
GTVKVAGRTYTGQQIPDFLLEILSDGGLVEHRKKQQRLNS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaggtaaagcatggatcttcggtgacgatgtggacaccgatgttataatcccg
ggtaaatacctgcgtaccaccgatatgcaggtctttgcagatcatgccatggaaggcatc
gaccccgatttttcaagcaaagtatctcccggtgacatcattgtcggcggcaacaatttc
ggctgtggctcctccagagagcaggcacccctggcactcaagcatgccggtgtgggttgt
gtggttgccagatccttcggacgcatttttttccgcaattccatcaatgtgggtttgccg
ctgattgaggcggatgtggagtgtgaggaaggtgatgaggtcgaagtcaacctctccgaa
ggcactgtgaaagtggcaggcaggacctatacaggccagcagatccccgatttcctgcta
gaaatactgagtgacggcgggcttgtcgagcatcgtaaaaaacaacaaaggctaaattca
tga

DBGET integrated database retrieval system