KEGG   Methanohalophilus mahii: Mmah_0223Help
Entry
Mmah_0223         CDS       T01211                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K15635  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_0223
   01230 Biosynthesis of amino acids
    Mmah_0223
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_0223
  Energy metabolism
   00680 Methane metabolism
    Mmah_0223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmah_0223
Enzymes [BR:mmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Mmah_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
250956..252140
Genome map
AA seq 394 aa AA seqDB search
MKHIVLIGDGMADYPIKELGDKTVLEAADTPHMDRMALEGINGLATNVPDGMPAGSDVAN
MSVLGYDPAKHYSGRAPLEAASMGIELDKNDVAFRCNLITIENGDILDHSAGHISTEEAS
QLMQAIEDELGGDVHFYPGISYRHLMVAQFGADAVCTPPHDVVEEPALDHMPRGDSAEKL
QELIRASWNILSEHPVNKKRIEEGKRPANSIWLWGQGYAPSMPSFEEMYGLKAAVISAVD
LIKGLGICEGMDVIEVPGATGYLDTNYVGKAEYALESLKDHDIVFVHVEAPDEAGHMGSL
EAKIQAVEDFDSKVVGTILEGIEKLSEECTVLVLPDHPTPIAVRTHTPDPVPFVIYPSFN
RDADIVKTYSEDAATDGILSTVRGCDLIRTMLSL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatattgtattaattggtgacggaatggcagattatcctattaaggaacttgga
gacaaaactgtattagaagctgcggatactcctcacatggaccgtatggcactggaggga
ataaatggactggctaccaatgttccggatgggatgcccgcaggtagtgatgtggctaat
atgtccgttcttggttatgatcctgccaaacattattcgggacgtgctcctttagaagca
gcaagtatgggtattgagctggataaaaatgatgttgctttccgttgtaacctgataaca
attgaaaatggcgatatactggatcacagtgcaggtcatatttccactgaagaagcaagt
caattaatgcaggcaattgaggatgaactgggtggggatgtccatttttatcctgggata
agttatcgccaccttatggttgcccaatttggtgcggatgctgtctgtacacctcctcat
gatgtggttgaggaaccggctttagatcacatgcctcggggtgattctgcagaaaaactc
caggaattgatcagggcttcttggaatatcctttccgagcatcctgtgaataaaaaacgc
attgaagaaggaaagagacctgccaattccatatggttatggggtcagggttatgctcct
tcgatgccttcttttgaagaaatgtacggattaaaagcagctgtaatatctgcagtcgac
cttatcaagggcctaggtatctgtgaaggaatggatgtaattgaagttcccggtgctacc
ggatatcttgatacaaattatgtgggtaaggcagaatacgctcttgaatccctgaaagat
catgacattgtttttgtccatgtagaagctccggatgaagcgggacatatgggtagtctg
gaggccaagatacaggcagttgaggactttgattccaaagtagtgggtaccatccttgaa
ggaatagaaaaactgtctgaagaatgtactgtacttgtccttcccgatcatccgacaccg
attgcagtaaggacccatactcctgatcctgtaccatttgtgatttatccatctttcaat
cgggatgccgatattgtcaaaacttactcagaagatgcagctacagatggtattctttca
actgtcaggggttgcgacctgatacgtaccatgctttccctttga

DBGET integrated database retrieval system