KEGG   Methanohalophilus mahii: Mmah_0223Help
Entry
Mmah_0223         CDS       T01211                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K15635  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_0223
   01230 Biosynthesis of amino acids
    Mmah_0223
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_0223
  Energy metabolism
   00680 Methane metabolism
    Mmah_0223
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmah_0223
Enzymes [BR:mmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     Mmah_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
250956..252140
Genome map
AA seq 394 aa AA seqDB search
MKHIVLIGDGMADYPIKELGDKTVLEAADTPHMDRMALEGINGLATNVPDGMPAGSDVAN
MSVLGYDPAKHYSGRAPLEAASMGIELDKNDVAFRCNLITIENGDILDHSAGHISTEEAS
QLMQAIEDELGGDVHFYPGISYRHLMVAQFGADAVCTPPHDVVEEPALDHMPRGDSAEKL
QELIRASWNILSEHPVNKKRIEEGKRPANSIWLWGQGYAPSMPSFEEMYGLKAAVISAVD
LIKGLGICEGMDVIEVPGATGYLDTNYVGKAEYALESLKDHDIVFVHVEAPDEAGHMGSL
EAKIQAVEDFDSKVVGTILEGIEKLSEECTVLVLPDHPTPIAVRTHTPDPVPFVIYPSFN
RDADIVKTYSEDAATDGILSTVRGCDLIRTMLSL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatattgtattaattggtgacggaatggcagattatcctattaaggaacttgga
gacaaaactgtattagaagctgcggatactcctcacatggaccgtatggcactggaggga
ataaatggactggctaccaatgttccggatgggatgcccgcaggtagtgatgtggctaat
atgtccgttcttggttatgatcctgccaaacattattcgggacgtgctcctttagaagca
gcaagtatgggtattgagctggataaaaatgatgttgctttccgttgtaacctgataaca
attgaaaatggcgatatactggatcacagtgcaggtcatatttccactgaagaagcaagt
caattaatgcaggcaattgaggatgaactgggtggggatgtccatttttatcctgggata
agttatcgccaccttatggttgcccaatttggtgcggatgctgtctgtacacctcctcat
gatgtggttgaggaaccggctttagatcacatgcctcggggtgattctgcagaaaaactc
caggaattgatcagggcttcttggaatatcctttccgagcatcctgtgaataaaaaacgc
attgaagaaggaaagagacctgccaattccatatggttatggggtcagggttatgctcct
tcgatgccttcttttgaagaaatgtacggattaaaagcagctgtaatatctgcagtcgac
cttatcaagggcctaggtatctgtgaaggaatggatgtaattgaagttcccggtgctacc
ggatatcttgatacaaattatgtgggtaaggcagaatacgctcttgaatccctgaaagat
catgacattgtttttgtccatgtagaagctccggatgaagcgggacatatgggtagtctg
gaggccaagatacaggcagttgaggactttgattccaaagtagtgggtaccatccttgaa
ggaatagaaaaactgtctgaagaatgtactgtacttgtccttcccgatcatccgacaccg
attgcagtaaggacccatactcctgatcctgtaccatttgtgatttatccatctttcaat
cgggatgccgatattgtcaaaacttactcagaagatgcagctacagatggtattctttca
actgtcaggggttgcgacctgatacgtaccatgctttccctttga

DBGET integrated database retrieval system