KEGG   Methanohalophilus mahii: Mmah_0225Help
Entry
Mmah_0225         CDS       T01211                                 

Definition
(GenBank) coenzyme F420-0 gamma-glutamyl ligase
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00680  Methane metabolism
mmh01120  Microbial metabolism in diverse environments
Module
mmh_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mmah_0225
Enzymes [BR:mmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Mmah_0225
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Mmah_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase
Motif
Other DBs
NCBI-ProteinID: ADE35758
JGI: Mmah_0225
UniProt: D5E9A7
Position
252874..253629
Genome map
AA seq 251 aa AA seqDB search
MEAFTVDDIPLIKPGDDIAAIICQRVGLEDGDVLVIASTIIAKAENELFSLDNITPSARA
IGIGKKDGKDPRLVQAVLDRCSECFVESPVMLVQSDRAHVCINSGVDDSNVENDLLADLP
RDADASARIIGERVEEITGCRVAVVVTDTNGRAFRLGQTGVAIGLYHATPIYYWRGKKDL
FGYEMQISEEAVADEVAAAANLLMGEGSGGNPVVVVRGTSLFTGGKTSACQLYRPDNMDI
IKKALRIFKES
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctttactgttgatgatatacctctgataaaacctggtgacgacattgcggcc
attatatgtcagcgtgtcgggctggaagatggcgatgtgctggttattgcttctaccata
attgcaaaagccgagaatgaactgttttcccttgacaatatcacgccctctgcccgggca
attgggattggtaaaaaggatggtaaagacccgcggcttgtacaggctgtactggacaga
tgcagtgagtgttttgtcgaatctcctgtaatgcttgtacaatccgacagggcacatgta
tgcatcaattcaggagtggatgattccaatgtcgagaatgatttacttgccgatcttccc
cgggacgcggatgccagtgccagaatcataggtgagagagttgaagagattacaggttgc
agggttgctgttgtggtaactgataccaatggcagggctttcagactgggccagacaggg
gttgcaatagggctgtaccatgccacacccatttattactggagaggtaaaaaggatctt
ttcggctatgaaatgcagatcagtgaagaggcggttgccgatgaagtggcagctgctgca
aacctgctgatgggggagggtagtggaggtaatccggtagttgttgtacggggcacatcc
ctgtttaccgggggaaagacatctgcctgccagctgtacaggccggacaatatggatatc
atcaagaaggccttacgcattttcaaggagtcttga

DBGET integrated database retrieval system