KEGG   Methanohalophilus mahii: Mmah_0230Help
Entry
Mmah_0230         CDS       T01211                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmh  Methanohalophilus mahii
Brite
Enzymes [BR:mmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mmah_0230
Transfer RNA biogenesis [BR:mmh03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mmah_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
257901..259532
Genome map
AA seq 543 aa AA seqDB search
MSDESDFAKACRKLVELVLEDSTLDKVQFNREKLNISRQYGLSTLPRNSDVIAAASDSEK
ESVRGLLRRKPVRTISGVAVIAVMTSPAPCPHGVCVPCPGGPASSFVSPQSYMGREPAAM
RGIQYEYDPYRIVHARLKQLQEIGHEVDKAELIVMGGTFTSRNLDYQEWFTKRCLEAMND
FKGHQWRDSVHNVYGYIPIEDVQEANESSAVRNIGITYETRPDWTSPVEVDRLLNFGATK
VEIGVQSVYDFVLSRMRRGHSVADTAEANRILRDSGLKVGFHMMPRLPGSDNERDMRGFK
KLFSDSRFMPDFLKIYPTLVTEGTELEKMWRAGKYDPLYDEEAVELLADIKAILPKWVRL
QRIQRDIPAQQILAGVKKSNIRQLAGQQLMQKGGKCSCIRCREVGHNILKERPPSIEDIE
FMVQSYFSCGGQEHFLSFEDVSQDILIGFLRLRFPNKPHRPELENSALVRELHVYGSMVA
VGGFAKGHDWQHRGYGLRLISEAENMAKDAGFEKLSIISGIGVREYYRKLGYILEGPYMV
KYL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgagagtgattttgctaaagcctgcaggaaacttgttgaactggttcttgaa
gattccacattggataaggtgcagttcaacagggaaaagctgaacatcagcaggcaatat
ggcctgtcaacgctgcctcgtaattccgatgtcatagccgctgcctctgatagtgaaaag
gaatctgtgcgcggccttctgcggcgtaaacctgtaaggacaatatccggtgtggcggtt
attgcggtcatgacatctcccgcaccctgtcctcacggtgtctgtgtgccctgccccggt
ggtcctgcatcttcttttgtttcccctcagagttatatgggaagggagcctgccgccatg
cggggcatacagtatgagtatgacccctacaggatagtgcatgcacgcctgaaacagttg
caggaaatcgggcacgaagttgataaggcagaacttatagtcatgggcggtacattcacc
tcccgcaatctggattaccaggaatggttcaccaaacgttgtcttgaagcgatgaatgat
tttaagggacaccaatggcgggatagcgtccataatgtttacggctatattcctattgaa
gatgtacaggaggccaatgagagttctgcggttcgcaacatcggtataacatatgaaaca
cgcccggactggacatctcctgtggaggtggaccggcttctgaattttggtgctacaaaa
gtggagatcggagtgcaaagtgtatatgattttgtactttcaaggatgcgtcggggccat
tcagttgccgataccgccgaggccaaccgcatattgcgcgatagtggcctgaaagtaggt
ttccatatgatgcctcgtctgccgggttcggataatgagcgggacatgcggggttttaaa
aaactgttcagtgattcgcgtttcatgccggatttcctgaagatctatccaactctcgta
actgaaggtacagagcttgaaaaaatgtggagggcaggaaagtacgatcccctctatgat
gaagaagctgtggaactgcttgctgatataaaagcaatacttcctaaatgggtgcggctg
caacgtatccagcgggatattcctgcacagcagatattggccggtgtgaaaaagagtaat
attcgccagcttgcaggccagcaacttatgcaaaaaggtggcaaatgcagttgtatacgt
tgcagggaagttggtcataatatcctgaaagaaaggccaccttcaatagaagatattgaa
tttatggtgcaatcctatttttcctgtggtgggcaggaacatttcctttcgtttgaagat
gtcagccaggatatcctgattggttttttgcgtttgagatttccgaacaagccacatcga
ccggaacttgagaattcggctcttgtacgggagctacatgtttatggttcaatggttgct
gtgggtggatttgcaaagggccatgactggcagcataggggttatggtctcaggttgatt
tcagaggctgagaatatggcaaaagatgctggctttgaaaaactcagtattatcagtggg
atcggggtgcgtgaatattatcggaaactggggtatattctggaaggtccctatatggta
aaatatctttaa

DBGET integrated database retrieval system