KEGG   Methanohalophilus mahii: Mmah_0235Help
Entry
Mmah_0235         CDS       T01211                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_0235
   01230 Biosynthesis of amino acids
    Mmah_0235
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_0235
   00051 Fructose and mannose metabolism
    Mmah_0235
   00562 Inositol phosphate metabolism
    Mmah_0235
Enzymes [BR:mmh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mmah_0235
Exosome [BR:mmh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mmah_0235
  Exosomal proteins of bladder cancer cells
   Mmah_0235
  Exosomal proteins of melanoma cells
   Mmah_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
263018..263686
Genome map
AA seq 222 aa AA seqDB search
MDSPLIVVNFKTYAQGTGEAAVGIATACRDVAEEAGVTIGVAPQLCDIYRVSSQVDVPVY
AQHVDGVSPGSNTGHVMASCVQQAGAVGSLINHSERRLNLADIEASVRAARAEGLTTIVC
TNNIPTTAAAAALDPEYVAVEPPELIGTGVPVSQADPDVVRGSVEAVKKINPDVQVLCGA
GISRGEDLIAAMELGSVGVLLASGIVKAEDPRSALEDLVSQL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggactcgcccctgatagttgtgaacttcaaaacctatgcacagggtacaggtgaggca
gcagtaggaattgctactgcctgcagggatgtcgcagaagaagcgggagtgaccataggt
gtcgctccccagctctgtgatatctacagggtgtcttctcaggtggatgtacctgtctat
gcccagcacgtggatggtgtttcaccgggtagcaataccggccatgtgatggcctcctgt
gtacaacaggcaggggcggtgggatctctcatcaatcattccgaacgcaggctcaacttg
gcagacattgaggcatcggtgcgtgcagcccgggctgaaggcctgaccaccattgtgtgc
accaataatattcccacaacagcagcagctgcagcccttgatccggaatatgttgcggtg
gaaccccctgaactcatcggaaccggtgtaccggtttcccaggctgacccggatgtcgtg
aggggctcggttgaagctgtaaaaaaaataaatcctgatgttcaggttttgtgtggggcg
ggtatatcccggggagaagatctaatagccgcaatggagcttggttccgtaggcgttctg
cttgcatcaggcatagtaaaggcagaagatcccaggtcagccctggaagatcttgtcagc
cagctttaa

DBGET integrated database retrieval system