KEGG   Methanohalophilus mahii: Mmah_0276Help
Entry
Mmah_0276         CDS       T01211                                 

Definition
coenzyme F420 hydrogenase/dehydrogenase subunit beta domain protein
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mmh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(296456..298372)
Genome map
AA seq 638 aa AA seqDB search
MADKKWFLKDNIVDTGMCTLCGACAAICPYDLIRFDENGPHLKDECYRNGEGACKDVCQR
VMTDASRIALNAFDFKAKPPSLLGQYEKIVSARATDEDLIKKGQDGGAVSSLIAYCIDNG
LIDGAITTAGFAKPAANIIGEREDITSSQGAKYSTVPVLSALRDQKDNFNKVAVVGTPCQ
TYGVRRMQYFNGLNVHPVEKGMDGESANTPKIEYVIGLFCMENFNYHKLSDFLEKQGIKL
NDIKKYSIQLDEMIITTDEKNIEISLKDLQDCVWDGCKICRDAVSKVADISAGSSGSSKG
WTTLIARNAKGLKLLNDANEAGYIEISNEVDIEMTKELAQFKIRKFRHELDKRLDSEKKV
SYYWVRDYPGVRPEINGTNFVKIKTDSGITTHEYLGKVAELAEKYGDGTLEMTARKSIEI
QGVPGRNIDDLMAEVYDAGLKTIGMGYATACPGMDYCPEGLVSTKELANKLTMHFAQKLT
PHKMKVGVAGCPNSCVRVRDHDIGIMGQLMPVIDETKCTGCGRCTELCKFNAISIEGGKA
VINRDLCGNCGWCVRGCPHEAALEDKRGYSLWIGGNGARRPTEGVLIKSFCDEEEIIETI
NDIARAFIKYRTNPGKERLGNIMDKIGQGTLIKEIMEN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaaaatggttcttaaaagataatattgtagatacaggcatgtgtaccctt
tgtggtgcatgtgctgctatttgtccatatgaccttatacgttttgatgaaaacggaccg
caccttaaagacgagtgctacaggaatggagaaggagcatgcaaagatgtatgccaacgg
gtaatgaccgatgcttcccggattgcacttaatgcttttgattttaaggcaaaacccccc
agcttgttgggtcaatacgaaaaaatagtgtctgcaagagcaacagatgaggatctcatc
aaaaaaggacaggacggaggagccgtctcttcccttattgcatactgtattgataatggg
ctcatagacggagccataacaacagccggttttgccaaacctgcagcaaacataattgga
gaaagggaagatataacttcatcccagggagccaaatattcaacagtgcctgtattatcc
gccctaagggatcaaaaagataatttcaacaaagtagcagtcgtaggaactccatgtcag
acctatggcgtccgtagaatgcaatatttcaatggccttaacgtgcaccctgtcgaaaaa
ggaatggatggggaaagtgccaatactcctaaaattgaatatgtaattggcctcttttgc
atggaaaatttcaattatcacaagttatccgatttcctggaaaaacagggaatcaaactt
aacgatattaaaaaatattccattcaacttgatgaaatgattataaccacggatgagaaa
aatattgaaatctccctgaaggaccttcaggattgtgtttgggatggctgtaagatttgc
agggacgcagtatcaaaggtcgctgatatttctgcaggaagctccggttcttcaaagggg
tggactacattgatagcccgcaatgccaaaggattgaaattgcttaatgatgcaaatgaa
gcgggttatattgagatatcaaatgaagtagatattgaaatgacaaaagaactggcacaa
ttcaaaatcagaaagttccgtcatgaacttgacaaacgtctcgattcagaaaaaaaagtc
agctactactgggttcgtgactatccgggtgtaaggccagaaataaatggaaccaacttt
gtcaaaataaaaaccgattcagggattaccacacacgaatatctgggaaaagttgcagaa
cttgccgaaaaatatggtgacggtacactggaaatgactgcaaggaaaagtatcgagatc
caaggtgtgcctggaagaaacattgatgatcttatggcagaggtatacgacgcgggattg
aagacaatcggaatgggatatgctacagcatgcccgggaatggattattgccccgaaggc
ctggtgagtacaaaagaacttgccaacaaacttacaatgcattttgcccagaaattgacg
ccacataaaatgaaagtaggtgtcgcaggctgtccaaatagttgtgtccgcgtaagagac
catgacataggtataatgggccagctcatgcctgtcattgatgaaacaaagtgcactggc
tgtggaagatgtaccgaactatgtaaatttaatgctatatccatagaaggaggaaaagca
gttataaaccgggatctttgtggaaattgtggatggtgtgtcagaggatgtccccatgaa
gctgccctggaagataaacgcggttactctttatggataggaggtaatggtgcacgccgt
cctacagagggagtattaatcaaatcattctgtgacgaggaagaaatcatagagacgatc
aatgatatagctagagcattcataaaataccgcacaaaccccggtaaagaaagattgggg
aatattatggacaaaataggccagggaactcttatcaaagaaatcatggaaaactga

DBGET integrated database retrieval system