KEGG   Methanohalophilus mahii: Mmah_0276Help
Entry
Mmah_0276         CDS       T01211                                 

Definition
(GenBank) coenzyme F420 hydrogenase/dehydrogenase beta subunit domain protein
  KO
K21816  
sulfite reductase (coenzyme F420) [EC:1.8.98.3]
Organism
mmh  Methanohalophilus mahii
Brite
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, physiological acceptors
    1.8.98.3  sulfite reductase (coenzyme F420)
     Mmah_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(296456..298372)
Genome map
AA seq 638 aa AA seqDB search
MADKKWFLKDNIVDTGMCTLCGACAAICPYDLIRFDENGPHLKDECYRNGEGACKDVCQR
VMTDASRIALNAFDFKAKPPSLLGQYEKIVSARATDEDLIKKGQDGGAVSSLIAYCIDNG
LIDGAITTAGFAKPAANIIGEREDITSSQGAKYSTVPVLSALRDQKDNFNKVAVVGTPCQ
TYGVRRMQYFNGLNVHPVEKGMDGESANTPKIEYVIGLFCMENFNYHKLSDFLEKQGIKL
NDIKKYSIQLDEMIITTDEKNIEISLKDLQDCVWDGCKICRDAVSKVADISAGSSGSSKG
WTTLIARNAKGLKLLNDANEAGYIEISNEVDIEMTKELAQFKIRKFRHELDKRLDSEKKV
SYYWVRDYPGVRPEINGTNFVKIKTDSGITTHEYLGKVAELAEKYGDGTLEMTARKSIEI
QGVPGRNIDDLMAEVYDAGLKTIGMGYATACPGMDYCPEGLVSTKELANKLTMHFAQKLT
PHKMKVGVAGCPNSCVRVRDHDIGIMGQLMPVIDETKCTGCGRCTELCKFNAISIEGGKA
VINRDLCGNCGWCVRGCPHEAALEDKRGYSLWIGGNGARRPTEGVLIKSFCDEEEIIETI
NDIARAFIKYRTNPGKERLGNIMDKIGQGTLIKEIMEN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaaaatggttcttaaaagataatattgtagatacaggcatgtgtaccctt
tgtggtgcatgtgctgctatttgtccatatgaccttatacgttttgatgaaaacggaccg
caccttaaagacgagtgctacaggaatggagaaggagcatgcaaagatgtatgccaacgg
gtaatgaccgatgcttcccggattgcacttaatgcttttgattttaaggcaaaacccccc
agcttgttgggtcaatacgaaaaaatagtgtctgcaagagcaacagatgaggatctcatc
aaaaaaggacaggacggaggagccgtctcttcccttattgcatactgtattgataatggg
ctcatagacggagccataacaacagccggttttgccaaacctgcagcaaacataattgga
gaaagggaagatataacttcatcccagggagccaaatattcaacagtgcctgtattatcc
gccctaagggatcaaaaagataatttcaacaaagtagcagtcgtaggaactccatgtcag
acctatggcgtccgtagaatgcaatatttcaatggccttaacgtgcaccctgtcgaaaaa
ggaatggatggggaaagtgccaatactcctaaaattgaatatgtaattggcctcttttgc
atggaaaatttcaattatcacaagttatccgatttcctggaaaaacagggaatcaaactt
aacgatattaaaaaatattccattcaacttgatgaaatgattataaccacggatgagaaa
aatattgaaatctccctgaaggaccttcaggattgtgtttgggatggctgtaagatttgc
agggacgcagtatcaaaggtcgctgatatttctgcaggaagctccggttcttcaaagggg
tggactacattgatagcccgcaatgccaaaggattgaaattgcttaatgatgcaaatgaa
gcgggttatattgagatatcaaatgaagtagatattgaaatgacaaaagaactggcacaa
ttcaaaatcagaaagttccgtcatgaacttgacaaacgtctcgattcagaaaaaaaagtc
agctactactgggttcgtgactatccgggtgtaaggccagaaataaatggaaccaacttt
gtcaaaataaaaaccgattcagggattaccacacacgaatatctgggaaaagttgcagaa
cttgccgaaaaatatggtgacggtacactggaaatgactgcaaggaaaagtatcgagatc
caaggtgtgcctggaagaaacattgatgatcttatggcagaggtatacgacgcgggattg
aagacaatcggaatgggatatgctacagcatgcccgggaatggattattgccccgaaggc
ctggtgagtacaaaagaacttgccaacaaacttacaatgcattttgcccagaaattgacg
ccacataaaatgaaagtaggtgtcgcaggctgtccaaatagttgtgtccgcgtaagagac
catgacataggtataatgggccagctcatgcctgtcattgatgaaacaaagtgcactggc
tgtggaagatgtaccgaactatgtaaatttaatgctatatccatagaaggaggaaaagca
gttataaaccgggatctttgtggaaattgtggatggtgtgtcagaggatgtccccatgaa
gctgccctggaagataaacgcggttactctttatggataggaggtaatggtgcacgccgt
cctacagagggagtattaatcaaatcattctgtgacgaggaagaaatcatagagacgatc
aatgatatagctagagcattcataaaataccgcacaaaccccggtaaagaaagattgggg
aatattatggacaaaataggccagggaactcttatcaaagaaatcatggaaaactga

DBGET integrated database retrieval system