KEGG   Methanohalophilus mahii: Mmah_0352Help
Entry
Mmah_0352         CDS       T01211                                 

Definition
pyruvate ferredoxin oxidoreductase, subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_0352
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_0352
   00020 Citrate cycle (TCA cycle)
    Mmah_0352
   00620 Pyruvate metabolism
    Mmah_0352
   00640 Propanoate metabolism
    Mmah_0352
   00650 Butanoate metabolism
    Mmah_0352
  Energy metabolism
   00680 Methane metabolism
    Mmah_0352
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mmah_0352
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mmah_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
367856..368116
Genome map
AA seq 86 aa AA seqDB search
MSIPLGGVCEPGTTRLNKTGGWRTFRPVYDYDKCIKCKLCELLCPDMAVLPRDDGFFEFD
YDYCKGCGICANECPTEAIDMVLEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgagcattccacttggaggagtctgtgaaccaggtactacgaggttaaacaagaccggt
ggctggaggactttcaggccagtctatgactacgataaatgtatcaaatgtaaattatgt
gaattgctctgtcccgacatggcggtactacccagggacgacgggttctttgaatttgat
tacgactactgcaaaggatgtggaatctgtgccaatgaatgtcccacggaagccattgat
atggtactggaggaaaaataa

DBGET integrated database retrieval system