KEGG   Methanohalophilus mahii: Mmah_0353Help
Entry
Mmah_0353         CDS       T01211                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_0353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_0353
   00020 Citrate cycle (TCA cycle)
    Mmah_0353
   00620 Pyruvate metabolism
    Mmah_0353
   00640 Propanoate metabolism
    Mmah_0353
   00650 Butanoate metabolism
    Mmah_0353
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mmah_0353
   00680 Methane metabolism
    Mmah_0353
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mmah_0353
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mmah_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
368117..369331
Genome map
AA seq 404 aa AA seqDB search
MTVIRTLEKDKMDVAEGSYAVAHAVKVCRPNIISAYPITPQTHIVEDLSQFMADGEIPNC
EYINVESEFSALSALVGSAAAGARCYSATTSQGLELMHEVLFNVSGMRLPVVMTIANRAV
SAPINIWNDHQDSISQRDTGWIQMYAEDLQEISDMTAQAYRVAEDKDVMMPAMTCMDGFI
LSHVYEPVVLLEQDLVDEYLPAFEPEYTLDPKNPLTFGAFADPSAYTEFRYLQQQAMDNA
LPKIEEAANEFYEIFGRYYGGLIDEYETEDADIILMAMGSLVGTIRDVVDKLRAKGVKVG
LLKVRTFRPFPAEAIKNVIKDAKVVVALDKNISLGLNEGSLFTETKASLYNTKVDVPIVG
RMLGHGGRDIPVKTIEDIVEEAKGIISSGINTESKYADLKEELL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacagttatacgtacccttgaaaaggataagatggatgtggccgaaggttcctatgca
gtggctcatgctgtgaaggtatgcaggccaaatattatttccgcatatcctatcacacca
cagacccatattgtggaggacctttcccagtttatggccgatggtgagattcccaactgt
gaatatataaacgtggaatccgagttctccgccctttcagccctagtgggatccgcagca
gcaggtgcacggtgttattcagccaccacctcacagggtctggaactgatgcacgaggtt
cttttcaatgtgtcagggatgcgcctgccagttgtaatgaccatagcaaatcgtgcggtc
agtgcccctatcaacatctggaacgatcatcaggattccatttcccagcgtgataccggc
tggatccagatgtatgctgaggacctgcaggaaatttcggatatgaccgcccaggcttac
agggttgcagaagataaggatgtaatgatgcctgcaatgacctgtatggatggtttcatc
ctgtctcatgtttatgagcccgtggtattgctggaacaggatcttgtggatgaatatctg
cctgcttttgaaccggaatatacactcgatcctaaaaacccgctgaccttcggtgccttt
gcagatccgagtgcatatacggaattcaggtatctgcagcaacaggcaatggataatgca
ctacccaaaatagaagaagctgccaatgagttctatgagatatttggaaggtactatggt
ggcctgattgatgaatatgagacagaagatgctgacatcatactcatggctatgggttca
cttgtgggaaccatcagggatgtcgtggataaactccgtgcgaaaggagtcaaggttggt
ttgcttaaagtaaggactttcaggccattcccggcagaagcaataaagaatgttatcaag
gatgccaaagtcgttgtcgcacttgacaagaacatctctttaggactcaatgaaggttct
ctctttaccgagaccaaggcaagcctgtataatactaaggttgatgtcccgatagtgggc
aggatgcttggccacggtggtcgtgacattcccgtaaaaaccattgaggacattgtagag
gaagccaaaggcataatctcttcgggtatcaatactgagagcaaatatgctgatctgaag
gaggaattgttgtga

DBGET integrated database retrieval system