KEGG   Methanohalophilus mahii: Mmah_0354Help
Entry
Mmah_0354         CDS       T01211                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00010  Glycolysis / Gluconeogenesis
mmh00020  Citrate cycle (TCA cycle)
mmh00620  Pyruvate metabolism
mmh00640  Propanoate metabolism
mmh00650  Butanoate metabolism
mmh00680  Methane metabolism
mmh00720  Carbon fixation pathways in prokaryotes
mmh01100  Metabolic pathways
mmh01120  Microbial metabolism in diverse environments
mmh01130  Biosynthesis of antibiotics
mmh01200  Carbon metabolism
Module
mmh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_0354
   00020 Citrate cycle (TCA cycle)
    Mmah_0354
   00620 Pyruvate metabolism
    Mmah_0354
   00640 Propanoate metabolism
    Mmah_0354
   00650 Butanoate metabolism
    Mmah_0354
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mmah_0354
   00680 Methane metabolism
    Mmah_0354
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mmah_0354
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mmah_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADE35886
JGI: Mmah_0354
UniProt: D5E9N5
Position
369328..370206
Genome map
AA seq 292 aa AA seqDB search
MKSLFTSGHRGCAGCCDAMVAKFTLMAAGEDCIVISPTGCLEVMSTPYPETSWEVPWIHS
LFENAGAVASGVEAALKAMGKKGDTKVIALAGDGATLDIGMRSISGAFERGHDITYVCID
NEAYMNTGVQRSGATPFDASTTTSPAGKVSYGNPRPKKNMPAIMAAHGSPYIATTSLGYP
KDMIKKIKKATEIEGPTYIHAHAPCTTGWGFDTSKTVEVAKLAVQTGLWPLYEMENGEVT
KVRKIGKQKKPVEDYLKMQKRFKHLFKMEGGEEQLKLIQALADKNIEDFGLE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcattgtttacatcaggacaccgtggttgcgcaggttgctgtgacgcaatggtg
gccaagttcacccttatggccgcaggggaagactgtatcgttatatctcctaccggctgt
ctggaagttatgagtacaccctatcctgaaacttcctgggaggttccatggatacactcc
cttttcgagaatgcaggagctgtggcttctggtgtggaagctgcccttaaagcaatgggt
aagaaaggtgataccaaggtaatcgctctggcgggagatggtgctacccttgatataggg
atgaggtccatttccggtgcctttgagcggggtcatgatattacctatgtatgtatcgat
aatgaggcatacatgaataccggtgtgcagagaagtggtgccacaccctttgatgcatcc
accacaacaagccctgccggaaaggtttcctatgggaatcccagacccaaaaagaacatg
cctgcaattatggcagctcatggttctccatacattgccacaacttcccttggttatccc
aaggacatgatcaagaagatcaagaaagcaacagagattgaaggtcccacctacatccat
gcccatgcgccctgtaccacaggttggggttttgacacttcaaagaccgtggaagttgca
aaactggcagtacagaccggtctgtggccgctgtatgaaatggaaaacggtgaagttaca
aaggtacgcaagataggtaaacagaaaaaacctgtcgaggattatctcaagatgcagaag
cggttcaaacatcttttcaaaatggaaggtggagaggaacagctcaaactgatccaggca
cttgcagataaaaatattgaagatttcgggcttgaataa

DBGET integrated database retrieval system