KEGG   Methanohalophilus mahii: Mmah_0410Help
Entry
Mmah_0410         CDS       T01211                                 

Definition
deoxyribodipyrimidine photo-lyase type II (EC:4.1.99.3)
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
mmh  Methanohalophilus mahii
Brite
Enzymes [BR:mmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     Mmah_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
428599..429972
Genome map
AA seq 457 aa AA seqDB search
MANIGRIHWLNEKPIGSGTYVLYWMQSSQRVDYNHALEFAIQQANKMDLPLLVLFCLTKY
PQANLRHYTFMLEGLVQTKKSLEKLGIQFVMLKGNPVDVVHEFARDASLLVTDQDYQKLQ
RGWRENLAASISCPFAQVESNVIVPVENVSDKEEWSAATLRRKIHKHLDEFVHPFELSAL
ANSSLEIDQDSLDLNDFEQILNSMDIDRSVKPSPRYKGGIHQAREKLSDFIAHRLGDYDE
KRNDPNLDFLSGMSPYLHFGQISPLEIALKVQDAKKGGSTAYMEELVVRRELAMNFVYYD
KDYDSLDCLPDWAKKTLAEHRDDFRQYIYTQEEFEQARTHDPYWNAAQREMVLTGKMHGY
MRMYWGKKILEWTDSPEQAYQIALYLNNKYELDGRDPNGYAGIAWCFGKHDRAWKERDIF
GKVRYMNANGLKRKFDAGGYVEKITRLEEKLGYLTDK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattggacggattcactggctcaacgagaaaccgattggaagcggaacatac
gtactctactggatgcaatcttcccagcgtgtggattataatcatgcactggaatttgct
atacagcaggcaaataaaatggatttgcctctactggttctattctgcctgacaaaatat
ccgcaagccaacctgcgtcattatacattcatgcttgaaggtttggttcaaacaaaaaaa
tccctggaaaaattgggtatacaatttgtgatgttaaagggaaacccggttgatgttgtc
catgagtttgcccgggatgcaagcctgttggttaccgatcaggattaccagaaattacag
cgcggttggcgtgaaaatcttgctgcatcgatttcctgtccttttgcgcaggtggaaagt
aatgttatagtgccggtggaaaatgtttccgataaggaggaatggtcggcagccaccctg
cgcaggaaaatccataaacatcttgatgaattcgtgcatccctttgaattatctgctttg
gccaattcttccctggaaattgatcaggattctctggatctgaatgattttgaacaaatt
ctgaatagtatggatattgacaggagtgtaaaaccctctccgagatataaagggggtatt
catcaggccagagaaaagctgtcagattttattgcacacagactgggagattatgatgaa
aaacgtaatgatccaaacctcgatttcctttcgggaatgagtccctatctgcatttcggt
caaatttcaccgcttgaaattgcactaaaggtccaggatgctaaaaagggtggatcaacc
gcatatatggaagaacttgttgttcgcagggaactggcaatgaattttgtgtattatgat
aaagattacgactcccttgactgccttcctgattgggcaaaaaagactcttgcagaacac
agggatgatttcagacagtacatatatactcaggaagagtttgagcaggcccgaactcat
gatccctactggaatgcagcccagagagaaatggtcctgacaggaaaaatgcacggttac
atgcgcatgtactggggcaagaagatactggaatggacagatagccccgagcaagcatat
cagatcgccctataccttaacaataaatatgagctggacggcagggatcctaacggttat
gcgggtattgcctggtgttttggcaagcatgaccgggcctggaaggaacgtgatattttc
gggaaggtgcggtatatgaatgccaacgggctaaagcggaaatttgatgctggtggttac
gtggaaaagattacccgtcttgaagaaaagctgggttatcttacggacaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system