KEGG   Methanohalophilus mahii: Mmah_0435Help
Entry
Mmah_0435         CDS       T01211                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmh  Methanohalophilus mahii
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
456435..457037
Genome map
AA seq 200 aa AA seqDB search
MAHKFYGWLNLYLTPMWQEMARIGKKLVDHGLVESHFGNISVRQGNSMVITRSGCPLDEI
CEENVVEVPIHNTCEFDGLASSETRVHRRIYQETDAGCIVHGHCPFAVVMSLLDESGSIE
PLDSEGVYFLGHVSIVEGSIGSEELAANSAAALAETNGVIVKSHGTISTGKTLDHAYINT
TQIEHTCKVRYYYDLAKRSL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacataaattttatggctggttgaacttatatctaactcctatgtggcaggaaatg
gcaagaatcgggaaaaaactcgtggatcatgggctggttgagtctcattttggaaatata
agtgtacgtcagggcaacagtatggtgataacccgcagtggatgcccgcttgatgagata
tgtgaggagaatgtggtggaggtgcccatccataacacctgcgaatttgacggtctcgca
tcgtcggaaacccgggtccacaggcgtatctatcaggagactgatgccggatgcatcgtg
cacggccactgtccctttgcagttgtgatgtcactgctggatgaatcgggcagtatcgaa
ccactggatagtgaaggtgtgtatttcctggggcatgtgtcgattgtggaaggcagtata
ggcagtgaagaacttgccgcaaactccgctgcggcgctagcagaaaccaacggggttatc
gtcaaaagccacggcaccatctccacaggaaaaaccctggaccatgcctacatcaacacc
acccagatagagcacacctgcaaagtgcgctattactacgatcttgctaaaagatccctg
tga

DBGET integrated database retrieval system