KEGG   Methanohalophilus mahii: Mmah_0564Help
Entry
Mmah_0564         CDS       T01211                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmah_0564
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmah_0564
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmah_0564
Enzymes [BR:mmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmah_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(588241..589542)
Genome map
AA seq 433 aa AA seqDB search
MEYTKYILDENDMPKKWYNILPDMPTPLEPPLNPATNEPIKPEELEPLFARELIKQEMSD
KRYINIPDEIKDIYKLWRPSPLYRASRLEKELDTPAKIYYKHEGVSPAGSHKPNTSIAQA
YYNMKEGTERITTETGAGQWGSALSLACNYFDIECKVYMVQSSFYQKPYRKSLINLWGAN
VIPSPSNETQFGRKIQEDFPDTSGSLGIAISEAVEDAALNDNTKYALGSVLNHVMHHQTI
IGLETQEQMKMAEDYPDIVIGCCGGGSNLAGIGLPFIKDKIDGNDLRVIGVEPSACPTLS
AGEFRYDYGDMAKMTPLLKMHTLGYDFIPPAIHAGGLRYHGCSPIISQLVNEGLMEATNY
HQIEVFEAGVTFARTEGFAPAPESSHAIKCAIDEALKCKETGEEKTILLNLSGHGHFDMT
SYDKYFNGELGNE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggaatatacaaaatatatactcgatgaaaatgatatgccaaaaaaatggtataacata
ttacctgacatgcccactccccttgagcctccattgaatcctgcaacaaatgaaccaatc
aaaccggaggaactcgaacctctttttgccagggaacttatcaaacaggaaatgtctgat
aagcgttacataaacatccccgatgaaataaaagatatctataagctctggagaccatca
cccctctaccgtgcctcaagacttgaaaaggaacttgacacacctgcaaaaatctactac
aaacatgaaggtgtgagccctgctggcagccacaaacccaacacctccattgcccaggct
tactacaacatgaaagagggaaccgaaaggatcactactgaaacgggagcaggacagtgg
ggaagtgctctttctcttgcatgcaactattttgatattgaatgtaaggtatacatggta
caatccagtttctaccagaaaccttacagaaaatccctcatcaacctctggggagcaaat
gtaattccatccccgagcaatgagacccagtttggcaggaagatacaggaagatttccct
gatacaagcggaagtctgggtatagccatcagtgaagctgtggaagatgctgctctcaat
gataataccaaatatgcattgggtagtgtacttaaccatgtaatgcatcaccagacaata
ataggactggaaacccaggaacagatgaaaatggccgaggattacccagacatcgtaatc
ggctgctgtggtggcggtagtaaccttgcaggaatcgggcttccattcatcaaagataaa
atagatggtaatgatctgagagttatcggtgtagaaccatccgcatgtcctaccttaagc
gcaggggaattcagatatgattacggtgatatggcaaaaatgacaccattgttgaaaatg
cataccctgggatacgatttcatcccgcctgcaatacatgccggtggactgcgctatcac
ggttgttcacccataatcagccagcttgtcaatgaaggtctcatggaagccacaaactac
caccagatcgaagtattcgaagcaggtgtgacctttgcccgcacagagggatttgcccca
gctcctgaatcatcccatgcaatcaaatgtgctatcgatgaagcactgaaatgcaaggaa
acaggggaagaaaagacaatcctgctcaatctgagtggccatggtcattttgatatgact
tcctatgacaagtatttcaatggggaacttggaaacgaataa

DBGET integrated database retrieval system