KEGG   Methanohalophilus mahii: Mmah_0746Help
Entry
Mmah_0746         CDS       T01211                                 

Definition
DNA ligase D, 3'-phosphoesterase domain protein
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mmh03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mmh03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mmh03430]
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:mmh03450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(771337..771795)
Genome map
AA seq 152 aa AA seqDB search
MLEEYRKKRDFDRTSEPEAKGTSRSGEPIFVIQKHDASNLHYDLRLEMNGVLKSWAVPKQ
PPKKAGIKRLAIQTEDHPMEYADFEGEIPEGQYGAGKVEIWDRGNYEAIKIEEKEIIVTL
KGKQLTGDYVLVKTKYGNNDKGWLFFKKKVEN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagaatacaggaaaaaaagagattttgacaggacatctgaacctgaagccaaa
ggaacttccagatctggtgagcctatttttgtaatacagaaacatgacgccagcaacctt
cattacgatctcaggctagagatgaatggcgtactgaaaagctgggcagttcccaaacaa
cctccaaaaaaagccggaatcaagagacttgccatacagacagaagatcacccaatggaa
tatgccgattttgagggagagatacctgaaggacaatacggagccggcaaagttgaaata
tgggacaggggaaactatgaagcaataaagattgaagaaaaggaaattatcgtcacacta
aaagggaagcaattgaccggtgactatgttcttgttaaaacaaagtatggcaacaacgat
aagggctggttatttttcaagaagaaagtagaaaactga

DBGET integrated database retrieval system