KEGG   Methanohalophilus mahii: Mmah_0840Help
Entry
Mmah_0840         CDS       T01211                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmh  Methanohalophilus mahii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mmah_0840
Enzymes [BR:mmh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mmah_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(862008..863060)
Genome map
AA seq 350 aa AA seqDB search
MEIEKLLEELANAHGISGNEEGIRKIMEREIKPYVDTIEVDKMGNLIGTKKGTGPSIMLA
AHMDEIGLMVKYVDENGFLRFVTIGGWFDQTLHSQRVMVHTNKGPIPGVIGSKPPHVMKD
EDKKKPIKAEEMFVDVGAKDKEDAENLGIEVGTPISIDRNFVALQNGLYTSKAFDNRVGV
AMVIDALKQISEMDIDATIYAVGTVQEEVGLKGARTSAFGLNPDIAIATDVTIPGDHPGI
EKKDSALEVGKGPVITVVDGAGRGLMADKQVVKWLKETAQENDLPHQLDVGDGGTTDATA
IHLTREGVPSSTISVAARYIHSPVEVISIDDLKASASLVAKAAKNVGKYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaaaaacttcttgaagaactggcaaacgcccacggaatttccggtaatgaa
gaaggaatccgcaaaatcatggaaagggaaatcaaaccttatgtcgataccatagaagta
gataaaatgggaaatctcataggtaccaaaaagggaacaggtccgtccattatgcttgcc
gcacacatggatgagataggcctgatggtaaaatatgtcgatgagaatggatttctccgg
tttgtgactataggtggatggtttgaccagactctgcacagccagcgtgtcatggtgcac
accaacaagggaccaatcccgggtgtcatcggttccaaaccccctcatgtaatgaaagat
gaggataaaaagaaaccgataaaggcagaagaaatgtttgtggatgtcggggcaaaggac
aaggaagatgctgaaaacttagggattgaagttggtacacccatttctatagacaggaac
ttcgtggcattgcaaaacggtctctacacctccaaagcctttgataaccgggttggagtg
gccatggtgattgacgccctgaaacaaatttccgaaatggacattgatgccacaatttat
gctgtgggaacggttcaggaagaggtggggcttaaaggtgcacgtacatctgctttcggt
ctgaatccggatattgcaattgcaacagatgtcaccatccccggtgatcatcccggtata
gaaaagaaggattcagccctggaagtaggcaaaggtccggtaattactgtggttgatggt
gccggcaggggcctgatggcagacaagcaggttgtcaaatggctaaaggaaacagcacag
gagaatgacctgccccaccagctcgatgtgggagacggaggaactaccgacgcaacggca
atacacctgacaagagagggtgtaccctcaagtactatcagtgtggccgcaaggtatatt
cactccccggtagaagtgatttccattgatgacctgaaagcaagcgcctctcttgtcgca
aaagcagctaaaaatgtagggaagtatttctaa

DBGET integrated database retrieval system