KEGG   Methanohalophilus mahii: Mmah_0840Help
Entry
Mmah_0840         CDS       T01211                                 

Definition
(GenBank) Cellulase
Organism
mmh  Methanohalophilus mahii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(862008..863060)
Genome map
AA seq 350 aa AA seqDB search
MEIEKLLEELANAHGISGNEEGIRKIMEREIKPYVDTIEVDKMGNLIGTKKGTGPSIMLA
AHMDEIGLMVKYVDENGFLRFVTIGGWFDQTLHSQRVMVHTNKGPIPGVIGSKPPHVMKD
EDKKKPIKAEEMFVDVGAKDKEDAENLGIEVGTPISIDRNFVALQNGLYTSKAFDNRVGV
AMVIDALKQISEMDIDATIYAVGTVQEEVGLKGARTSAFGLNPDIAIATDVTIPGDHPGI
EKKDSALEVGKGPVITVVDGAGRGLMADKQVVKWLKETAQENDLPHQLDVGDGGTTDATA
IHLTREGVPSSTISVAARYIHSPVEVISIDDLKASASLVAKAAKNVGKYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaaaaacttcttgaagaactggcaaacgcccacggaatttccggtaatgaa
gaaggaatccgcaaaatcatggaaagggaaatcaaaccttatgtcgataccatagaagta
gataaaatgggaaatctcataggtaccaaaaagggaacaggtccgtccattatgcttgcc
gcacacatggatgagataggcctgatggtaaaatatgtcgatgagaatggatttctccgg
tttgtgactataggtggatggtttgaccagactctgcacagccagcgtgtcatggtgcac
accaacaagggaccaatcccgggtgtcatcggttccaaaccccctcatgtaatgaaagat
gaggataaaaagaaaccgataaaggcagaagaaatgtttgtggatgtcggggcaaaggac
aaggaagatgctgaaaacttagggattgaagttggtacacccatttctatagacaggaac
ttcgtggcattgcaaaacggtctctacacctccaaagcctttgataaccgggttggagtg
gccatggtgattgacgccctgaaacaaatttccgaaatggacattgatgccacaatttat
gctgtgggaacggttcaggaagaggtggggcttaaaggtgcacgtacatctgctttcggt
ctgaatccggatattgcaattgcaacagatgtcaccatccccggtgatcatcccggtata
gaaaagaaggattcagccctggaagtaggcaaaggtccggtaattactgtggttgatggt
gccggcaggggcctgatggcagacaagcaggttgtcaaatggctaaaggaaacagcacag
gagaatgacctgccccaccagctcgatgtgggagacggaggaactaccgacgcaacggca
atacacctgacaagagagggtgtaccctcaagtactatcagtgtggccgcaaggtatatt
cactccccggtagaagtgatttccattgatgacctgaaagcaagcgcctctcttgtcgca
aaagcagctaaaaatgtagggaagtatttctaa

DBGET integrated database retrieval system