KEGG   Methanohalophilus mahii: Mmah_1009Help
Entry
Mmah_1009         CDS       T01211                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_1009
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_1009
   00620 Pyruvate metabolism
    Mmah_1009
   00640 Propanoate metabolism
    Mmah_1009
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mmah_1009
   00680 Methane metabolism
    Mmah_1009
Enzymes [BR:mmh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mmah_1009
Lipid biosynthesis proteins [BR:mmh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mmah_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1035893..1037365
Genome map
AA seq 490 aa AA seqDB search
MTSLIDNFLAKTDFESYDDFHANFKINIPENFNFVYDVVDVYAKEQPEKKALVWCNDNGE
EKIFTFADLKYYSEKSASLFSKYGIKKGDVVKLTLKGRYEFWVCILGLHRIGAIALPGTH
MLTTRDLKYRIERADIQMVVSNADEGLLDHIDEAHKDFKDVLKHKFVINHNRPGWINFTE
ELEKSPAEFVRPKGEEATQNNDISLMYFSSGTTGFPKMVQHDFTYPLAHILTAGYWQNVM
DNGLHLTVADSGWAKCAWGKIYGQWICGSAVFAYDYERFDARNMLEKASHYGVTTFCAPP
TVYRFLIKEDMSQYDFSSLNYCVVAGEPLNPEVYEKFLKYTDLKLMEGFGQTETVVAIAT
YPWMEPKPGSMGKPSPIYNIQLMRPDGKLADVGEEGEIVIDTSQGRPIGLFAGYRADPEK
TEAAWHDGYYHTGDMAWKDEDGYMWFVGRADDIIKSSGYKIGPFEVESALMQHPAVLECA
ITASPHPVRG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacttatagataattttttggcaaaaacagattttgaatcatacgatgatttc
cacgctaattttaagatcaacatccctgagaattttaattttgtatatgatgttgttgat
gtgtatgccaaggagcagcctgaaaaaaaggctcttgtctggtgtaacgataacggtgaa
gaaaagatattcacttttgctgatctgaaatattacagtgaaaaatctgccagccttttc
agtaaatatggaataaaaaagggtgatgtggtaaaacttaccttaaagggaagatatgaa
ttctgggtatgtatactgggattgcacagaattggtgccatcgctcttcccggcacgcat
atgctaacaaccagggatctcaaataccgcattgaaagagcagacatacaaatggtcgtc
agtaatgctgatgaagggcttttagatcacatagatgaggcacacaaggatttcaaagat
gtgctcaagcacaaatttgtaattaaccacaatcgtcccggctggattaattttacagaa
gaactggaaaaatcacccgccgaatttgtacgtccaaaaggagaggaagcaacacagaac
aatgacatatccctgatgtatttctcatccggcacaaccggcttcccgaaaatggtacaa
catgattttacatatccccttgcccatatactcacagccggctactggcagaatgtaatg
gacaatggtctgcatctcacagtagcagattcgggctgggcaaaatgtgcctggggaaaa
atctacggccagtggatttgcggctcagctgtctttgcttatgattatgagagattcgat
gccaggaatatgctggaaaaagccagccattatggtgtgaccacattctgtgcaccacct
acagtatatcgcttcctgataaaggaagacatgagccagtacgattttagcagtctcaat
tactgtgtggttgcaggagagcctttgaatcccgaggtgtatgaaaaattcctgaaatat
accgatctcaaactaatggaaggattcggccagacagaaacagttgtagccattgcaaca
tatccatggatggaaccaaaacccgggtcaatgggaaagccctcaccaatctataatata
cagttgatgcgtcctgacggaaaacttgccgatgttggagaagaaggagaaattgtaatc
gatacatcacagggcagacccataggtctgtttgcaggctatcgtgcagatcctgaaaag
acagaggcagcctggcatgacggttattaccataccggtgacatggcatggaaagatgaa
gacggatatatgtggtttgtaggacgagcagatgatatcatcaagagctctggttacaaa
atagggccatttgaagttgaaagtgcacttatgcagcatcctgcggtcctggaatgtgca
atcactgcatcccctcatcctgtacgtgggtag

DBGET integrated database retrieval system