KEGG   Methanohalophilus mahii: Mmah_1159Help
Entry
Mmah_1159         CDS       T01211                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00010  Glycolysis / Gluconeogenesis
mmh01100  Metabolic pathways
mmh01110  Biosynthesis of secondary metabolites
mmh01120  Microbial metabolism in diverse environments
mmh01130  Biosynthesis of antibiotics
mmh01200  Carbon metabolism
mmh01230  Biosynthesis of amino acids
Module
mmh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_1159
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mmah_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C Semialdhyde_dh Sacchrp_dh_NADP GFO_IDH_MocA IlvN
Motif
Other DBs
NCBI-ProteinID: ADE36664
JGI: Mmah_1159
UniProt: D5EBW3
Position
1172542..1173546
Genome map
AA seq 334 aa AA seqDB search
MTVKVAINGYGTIGKRVADAVSVQDDMEIIGVAKTRPNFEAFMAKKKGFDVFAPEDRIRG
MEEANLEVEGSIDDMIERADVVVDCTPGGIGEKNKPIYEKAGVKAIWQGGEDHELAGCSF
NAQSNYEEALGRDFVRVVSCNTTGLCRVIKPLDDEFGVNKARVTLMRRAADPGDIKKGPI
NAIVPNPIKLPSHHGPDVKTVLPGIDIATTAVKLPTTLMHLHTVNMELNSECTAEEIEDL
LAKQSRVRFVGQGITSTAEVMELARDMNRPRCDMWENCVWNESITIYEGELYFFQGIHQE
SDVIPENVDAIRAMMEIEKDGTKSVAKTNKAMGI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaaagttgcaattaacggttacggaactatcggaaagagagttgcagacgct
gtaagcgtccaggacgacatggaaattattggtgtggcaaaaacccgccctaattttgaa
gcttttatggcaaagaaaaagggatttgatgtatttgcacctgaagatagaataagggga
atggaagaggcaaaccttgaggttgaaggttccattgacgatatgattgaaagagcagat
gtcgttgtagactgtacccccggtggaattggtgaaaagaacaaaccaatttatgaaaaa
gcaggcgtcaaagctatctggcagggtggggaagaccacgaacttgcaggttgttcattc
aatgcacaaagcaattatgaagaagcactcggaagggattttgtgcgagtggtttcctgt
aatacgactggactctgcagggtcatcaaacctcttgatgacgagtttggagtgaacaaa
gcaagagtaacccttatgagaagggctgcggatcccggagatatcaagaaaggaccaatc
aatgctattgttcccaatcccataaagctaccttcccaccatggcccggatgtcaaaacc
gtcctcccaggcatcgatatcgctactacagctgtgaaacttcctacaacccttatgcac
ctgcacactgtcaacatggaactaaatagcgaatgtacggcagaagaaatagaagattta
ctggccaaacaatcacgtgtgcgctttgttggacagggtatcacatccacggccgaggtc
atggaattggctcgtgacatgaaccgcccaagatgtgacatgtgggaaaactgtgtgtgg
aacgaatccatcacgatatatgaaggagaactctacttcttccagggaattcaccaggaa
tcagatgtaattcccgaaaatgtcgatgcaataagggctatgatggaaattgaaaaggac
ggaacaaaatccgtagcaaaaactaacaaagcaatgggtatctaa

DBGET integrated database retrieval system