KEGG   Methanohalophilus mahii: Mmah_1203Help
Entry
Mmah_1203         CDS       T01211                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmh  Methanohalophilus mahii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmah_1203
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmah_1203
Enzymes [BR:mmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mmah_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227351..1228151
Genome map
AA seq 266 aa AA seqDB search
MHPKIEQIVQKSKERADALSENKTHTICNDRRDIFESIGLACKKGHIPIIAEVKPASPTG
KFADVNPEIASQIACDMENAGAVALSVLTEPCYFEGSIENLESARKNTSIPVLRKDFIVD
KSQMHEASSDLILLIAGVLGKKLPEFIEIARRRNIEPLVEVHDEKELEYVLECDTNLIGI
NNRSFETLEIDLETAEKLIPLVKEHDRKYNQKHLIIGESGVKGTDDATRMIRAGADALLV
GTYLMEGNLKEKMKHLIEANKNQEIV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgaagatcgaacaaatagtccaaaaatcaaaagaaagggcagacgcactttct
gaaaataaaacacacactatatgtaatgatagaagggatattttcgaatctatcgggctt
gcctgtaaaaaaggacacatacccataattgccgaagtaaagcctgcttcaccaacaggc
aaatttgctgatgtaaacccggaaatagcctcacaaattgcctgtgatatggaaaatgct
ggagctgtagccttatcagtccttacggaaccctgttactttgagggaagtatagaaaac
cttgaaagtgcaaggaaaaatacttccattccagttttacgcaaagattttattgtggac
aaaagtcagatgcatgaagcaagcagtgatctcatattgttgattgcaggggtactgggc
aaaaagctaccggaattcatagaaatagctcgaagaaggaacatagagcctctggtagag
gtacacgatgaaaaagagcttgaatatgtacttgaatgtgatacaaatcttatagggata
aataaccgcagttttgaaacccttgaaatcgatctggaaaccgctgaaaagctcattccc
cttgtgaaagaacatgaccgtaaatacaaccagaaacacctgataataggggaaagtgga
gtcaagggcacagatgatgcgacaaggatgatcagggcaggtgctgacgcgttgcttgtt
gggacctacctgatggaaggcaatcttaaagaaaaaatgaaacatcttattgaagcgaat
aagaatcaggagatagtatga

DBGET integrated database retrieval system