KEGG   Methanohalophilus mahii: Mmah_1204Help
Entry
Mmah_1204         CDS       T01211                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmah_1204
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmah_1204
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmah_1204
Enzymes [BR:mmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmah_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1228148..1229320
Genome map
AA seq 390 aa AA seqDB search
MNHYYGDYGGQYVPEILMPPLQELEEAYEQYKADPEFTSQLNDYLENYAGRSTPLYYAKN
MSAKYGIKIYLKREDLVHGGAHKLNNTLGQALLAKFMGKKRLIAETGAGQHGTATAMVGA
KLGFETMVYMGSKDVKRQLPNVYRMKLMGTEVVSVETGSKTMKDAINEALRDWVTNVGDT
HYLIGSVVGPYPFPKIVRDFQSVIGREVKEQVMKVEGRYPDSIVACAGGGSNAMGIFYPF
LDGEVNLFAVEAGGEKLREDDKIAYHSASLATGEEGILHGARTKVLQNRDGQILESTSVA
AGLDYAGVGPELARLAETGRVKPCYITDMEALEAFHELSRLEGIIPALESSHAIAYVTKM
ADSGILGDTVVINLSGRGDKDLQTIMNMEE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaccattattatggagactacggtggacaatacgtaccggaaatattgatgccgcca
cttcaagaacttgaagaagcgtatgaacaatataaggcagatccggagtttacctcccag
cttaatgactaccttgaaaattatgcaggaagaagtactcccctatattatgcaaagaac
atgagtgccaaatacggcataaaaatctacctcaaacgggaagacctcgtacatggagga
gcacacaaactcaacaataccctgggacaggcccttcttgcaaaattcatgggcaaaaaa
aggttaatcgcagaaacaggagccggtcaacacggtactgcaactgccatggtgggagca
aaactgggatttgaaaccatggtatacatgggatcaaaagatgtaaagagacagctccca
aatgtctaccgtatgaaactgatgggtactgaggtagtatcagttgaaaccggttcaaag
acaatgaaagatgcaataaatgaagcattgagggactgggtcacaaatgtcggagataca
cactacctcattggttcggtagtcggcccatatccattccctaagattgtgagggatttc
cagagcgttatcggcagggaagtaaaggagcaggtcatgaaagtggaaggaaggtacccg
gattctatcgtggcctgtgcaggcggcggaagtaatgcaatgggtattttctaccctttc
ctggatggtgaagtaaatctctttgcagtagaagcagggggcgaaaaactcagggaagac
gataaaatcgcctaccattctgcatccctggcaacaggtgaggaaggcatcctgcatgga
gccagaacaaaggtcctgcagaacagggacggacagatactggaatccacatccgtagca
gctggtctggattatgcaggagtggggcccgaactagcccgactcgcagaaacaggccgg
gtgaaaccctgttacataactgatatggaagccctcgaggcattccatgagcttagccgg
ctagaaggaataatccctgcactggaatcttcacatgccattgcatatgtcaccaaaatg
gcagatagcggcatactgggtgatacagtagttatcaatctctccggcaggggcgataag
gatctccagactattatgaatatggaggagtga

DBGET integrated database retrieval system