KEGG   Methanohalophilus mahii: Mmah_1205Help
Entry
Mmah_1205         CDS       T01211                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mmah_1205
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mmah_1205
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mmah_1205
Enzymes [BR:mmh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mmah_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1229323..1230096
Genome map
AA seq 257 aa AA seqDB search
MRISQKFEELKDKNEKALIAYVCAGDPDTATTPSIVNALVEAGADIIELGLPFSDPVADG
PTIQAATCRAIEAGMNTERYFEMIKGLEVNVPLVCMTYYNLIYRHGSENFVKRCAEAGIS
GLIIPDLPLHEADELIEICKEEGIDNIFLVAPNTSDQRLDAISSKSSGFIYVVSKLGVTG
EGKNISSNVAGLLDKINSTLPKAVGFGISNRKHVEEMVAAGADAVIVGSALVNIIASKDD
VIPRLKEITKDLKEGCR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcagtcaaaaatttgaagaacttaaggacaaaaatgaaaaagcactgattgcc
tatgtctgtgcgggagaccccgatacggccaccacaccttctattgtaaatgcccttgtt
gaagccggcgcggatataatagagctggggctgcctttctccgatcctgtggcagacggg
ccaaccatacaggccgcaacctgtcgtgccattgaggccggtatgaacacagagcgctat
tttgagatgataaaaggcctggaagtaaatgttcccctcgtctgtatgacctattacaat
ctcatatatcgccatggtagcgaaaatttcgtaaagaggtgtgcagaagcaggaatttcg
ggattgataatacccgatctgccattgcatgaagcagatgaactgatagaaatctgtaaa
gaggagggaattgataatatattccttgtcgcaccaaataccagtgatcaaagactggat
gcaattagcagcaaaagttcgggttttatctatgtagtatccaaactaggggttaccgga
gaaggaaaaaacatctcgtccaatgtagcaggccttctggataaaatcaattcaacccta
ccaaaagctgtaggttttggaatatcaaacagaaaacatgtagaagaaatggtcgctgca
ggagctgatgcagtgatcgtgggttctgcccttgtaaatataatagccagcaaagatgat
gtaattccccggttaaaagaaataacaaaggacttaaaagaaggatgcagataa

DBGET integrated database retrieval system