KEGG   Methanohalophilus mahii: Mmah_1227Help
Entry
Mmah_1227         CDS       T01211                                 

Definition
N-acetylglutamate kinase (EC:2.7.2.8)
Orthology
K00930  
acetylglutamate kinase [EC:2.7.2.8]
Organism
mmh  Methanohalophilus mahii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Mmah_1227
   01230 Biosynthesis of amino acids
    Mmah_1227
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mmah_1227
Enzymes [BR:mmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     Mmah_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1245973..1246860)
Genome map
AA seq 295 aa AA seqDB search
MSEGHYKKENILIEALPYIREFYDSFMVIKVGGHAMVDPEIMSAIVEDIVLLRFVGIHPV
IVHGGGPEITEKMEQMGKKPEFVGGLRITDDETVEIARMVLVGSINTKIVSLIGQHGAKG
VGLSGKDGKMIMARKKPAQRVMIEDIEHSVDLGWVGETEIINPELIHIVTDQGYIPVISP
IAVDNEGNALNINADTVAGDIAKSLQAKKLILMTDVAGLMRDPSDTTTRISRVLAPQVED
LIDEGIIGGGMIPKMRSASTSVKNGVERVHIINGSVPHSILLELFTDGGIGTMVF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggccactataagaaggaaaacatattgattgaagcccttccctacattcgt
gaattttatgattcttttatggtgataaaagttggagggcacgcaatggtagatcccgaa
ataatgagtgcaattgttgaggatattgtgcttctcagatttgtgggtatacatccggtc
atcgtacatggcggtggacctgaaatcactgaaaaaatggagcagatgggcaaaaaacct
gaatttgtaggcggcttgcgcattaccgatgatgagactgtggaaattgcccgtatggtc
cttgtaggtagtatcaatacgaaaattgtgtccctgattggccagcacggtgcaaaaggt
gtgggtctttccggtaaagacgggaaaatgataatggcgcgcaaaaaacctgcccagagg
gttatgatagaggatatcgagcatagtgtggatctggggtgggttggagaaaccgagata
atcaatccggaattgatccatatagtgacagatcagggctacattcctgtgatatctccg
attgctgtggataatgagggcaatgccctgaatatcaatgcagatacggttgccggagat
attgccaaatcactgcaggccaagaaactcatcctaatgacagatgtagcaggacttatg
agggatccttcagacactactacaaggatttcacgggtacttgcacctcaggttgaggat
ctgattgatgagggaattattggtggcggtatgatccccaaaatgcgcagtgcatccaca
agtgtgaaaaacggtgtagaaagggtgcatataataaatggaagtgtgccccattccatc
cttctggaattgtttacagatggaggaataggcactatggtattctaa

DBGET integrated database retrieval system