KEGG   Methanohalophilus mahii: Mmah_1278Help
Entry
Mmah_1278         CDS       T01211                                 

Definition
(GenBank) AMP phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
mmh  Methanohalophilus mahii
Brite
Enzymes [BR:mmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mmah_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_trans_3N Glycos_transf_3 Molydop_binding PYNP_C CDC48_N Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ADE36782
JGI: Mmah_1278
UniProt: D5E6J4
Position
complement(1292179..1293648)
Genome map
AA seq 489 aa AA seqDB search
MELKVQPIDVKVGKYKVILNSIDAKELGVYEGDRVRVTGHVTVTAIVDFTEDMISPGMIG
LYHEIKEKLQREWTEIVEIEPAERPKSARIIRKNMDGERLAQEEIHGLVKDIVEENLSEI
ELAAFLTSTYINDMTDDETEWLTRAMIDTGEKLEFAKGPIMDKHSIGGVPGNKISLLVVP
IVAANGLLIPKTSSRAITGAGGTSDLMEVLAPVEFSATEVKEMTEKVGGVLVWGGATNIA
PADDKLIKVEYPLSIDPHCQLLASIMAKKGAVGADNVVIDIPTGPGTKIANVQQGRKLAR
DLINLGERLGMNVDCALTYGASPVGRTVGPALEVREALKVLETGEGPNSLIEKSMVLAGM
LLEMGGVAARGQGNELAMETLKNGKALAKFREIIEVQGGDPSVSYKDITVGEHTAEITAP
ANGYVLEFKNKRVVQIARLAGAPNDKGAGVLIHKKQGEPVKKANRFLSFMQKRKINWKQL
CRMPREILL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaggtccagccaatcgatgtcaaagtcggaaaatacaaagttattctgaat
tccatagatgcaaaggaacttggtgtctatgaaggtgacagggtgcgggttacaggacat
gttacagttactgcgattgttgattttaccgaggatatgatttctccgggaatgatcggt
ctgtaccatgagataaaagagaaattacagagggaatggaccgagatcgtcgagattgaa
cccgcagagaggcccaaatcagcaaggatcatacgtaagaatatggatggggaaagactc
gctcaggaagaaatacacggccttgtgaaggacattgtcgaagagaacctgagtgaaatc
gaattagccgctttcctgacatccacatatatcaatgatatgacagatgatgaaactgaa
tggctgacccgggcgatgatagatacaggagaaaaacttgaatttgcgaagggtcctatc
atggataagcattctatcggaggagtgcccggaaacaaaatttccctcctggtagtacca
attgtagcagctaacgggctactgattccaaaaacaagttcccgtgcaattacaggtgca
ggaggcacgtccgatcttatggaagttctggcaccagtggaattctctgccacagaagta
aaagagatgaccgaaaaggttggaggtgttctggtctggggtggcgccaccaatattgcc
cctgcggatgacaaacttatcaaggttgaatatccgttgtcaattgatccgcattgccag
ctgctggcatccattatggccaaaaaaggagcagttggtgctgataatgtggttattgac
atacccaccggccccggcaccaaaatcgcaaacgtgcagcaaggtagaaaacttgctcgt
gatcttatcaatctgggtgagcgactcggcatgaatgttgactgtgcccttacctacggt
gcttccccggttggtcggactgttggacccgcacttgaagtacgtgaggctcttaaggta
cttgaaaccggagaaggaccaaacagccttatcgagaaaagtatggtccttgcgggtatg
ttgcttgagatgggtggggtggctgcccgtggtcagggcaatgaacttgccatggaaacc
cttaaaaatggcaaagctcttgccaaattccgggaaatcatagaagtacagggcggtgac
cccagtgttagttataaggacattactgtcggtgaacatacagctgagataaccgcacct
gcaaatggatatgtacttgaattcaaaaataagagagtggtacagattgcacggcttgcc
ggtgcacccaatgataagggagccggtgtgctgattcataagaaacagggcgaaccggtc
aaaaaggcgaaccggttcttatcattcatgcagaaaagaaaaataaactggaaacagctc
tgcagaatgcccagagagattctcctatag

DBGET integrated database retrieval system