KEGG   Methanohalophilus mahii: Mmah_1278Help
Entry
Mmah_1278         CDS       T01211                                 

Definition
AMP phosphorylase (EC:2.4.2.- 2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmh  Methanohalophilus mahii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mmah_1278
Enzymes [BR:mmh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mmah_1278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1292179..1293648)
Genome map
AA seq 489 aa AA seqDB search
MELKVQPIDVKVGKYKVILNSIDAKELGVYEGDRVRVTGHVTVTAIVDFTEDMISPGMIG
LYHEIKEKLQREWTEIVEIEPAERPKSARIIRKNMDGERLAQEEIHGLVKDIVEENLSEI
ELAAFLTSTYINDMTDDETEWLTRAMIDTGEKLEFAKGPIMDKHSIGGVPGNKISLLVVP
IVAANGLLIPKTSSRAITGAGGTSDLMEVLAPVEFSATEVKEMTEKVGGVLVWGGATNIA
PADDKLIKVEYPLSIDPHCQLLASIMAKKGAVGADNVVIDIPTGPGTKIANVQQGRKLAR
DLINLGERLGMNVDCALTYGASPVGRTVGPALEVREALKVLETGEGPNSLIEKSMVLAGM
LLEMGGVAARGQGNELAMETLKNGKALAKFREIIEVQGGDPSVSYKDITVGEHTAEITAP
ANGYVLEFKNKRVVQIARLAGAPNDKGAGVLIHKKQGEPVKKANRFLSFMQKRKINWKQL
CRMPREILL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaggtccagccaatcgatgtcaaagtcggaaaatacaaagttattctgaat
tccatagatgcaaaggaacttggtgtctatgaaggtgacagggtgcgggttacaggacat
gttacagttactgcgattgttgattttaccgaggatatgatttctccgggaatgatcggt
ctgtaccatgagataaaagagaaattacagagggaatggaccgagatcgtcgagattgaa
cccgcagagaggcccaaatcagcaaggatcatacgtaagaatatggatggggaaagactc
gctcaggaagaaatacacggccttgtgaaggacattgtcgaagagaacctgagtgaaatc
gaattagccgctttcctgacatccacatatatcaatgatatgacagatgatgaaactgaa
tggctgacccgggcgatgatagatacaggagaaaaacttgaatttgcgaagggtcctatc
atggataagcattctatcggaggagtgcccggaaacaaaatttccctcctggtagtacca
attgtagcagctaacgggctactgattccaaaaacaagttcccgtgcaattacaggtgca
ggaggcacgtccgatcttatggaagttctggcaccagtggaattctctgccacagaagta
aaagagatgaccgaaaaggttggaggtgttctggtctggggtggcgccaccaatattgcc
cctgcggatgacaaacttatcaaggttgaatatccgttgtcaattgatccgcattgccag
ctgctggcatccattatggccaaaaaaggagcagttggtgctgataatgtggttattgac
atacccaccggccccggcaccaaaatcgcaaacgtgcagcaaggtagaaaacttgctcgt
gatcttatcaatctgggtgagcgactcggcatgaatgttgactgtgcccttacctacggt
gcttccccggttggtcggactgttggacccgcacttgaagtacgtgaggctcttaaggta
cttgaaaccggagaaggaccaaacagccttatcgagaaaagtatggtccttgcgggtatg
ttgcttgagatgggtggggtggctgcccgtggtcagggcaatgaacttgccatggaaacc
cttaaaaatggcaaagctcttgccaaattccgggaaatcatagaagtacagggcggtgac
cccagtgttagttataaggacattactgtcggtgaacatacagctgagataaccgcacct
gcaaatggatatgtacttgaattcaaaaataagagagtggtacagattgcacggcttgcc
ggtgcacccaatgataagggagccggtgtgctgattcataagaaacagggcgaaccggtc
aaaaaggcgaaccggttcttatcattcatgcagaaaagaaaaataaactggaaacagctc
tgcagaatgcccagagagattctcctatag

  All links  
No link information was found.   
DBGET integrated database retrieval system