KEGG   Methanohalophilus mahii: Mmah_1375Help
Entry
Mmah_1375         CDS       T01211                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmh  Methanohalophilus mahii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_1375
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmah_1375
   00620 Pyruvate metabolism
    Mmah_1375
   00640 Propanoate metabolism
    Mmah_1375
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mmah_1375
   00680 Methane metabolism
    Mmah_1375
Enzymes [BR:mmh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mmah_1375
Lipid biosynthesis proteins [BR:mmh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mmah_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1376879..1378819)
Genome map
AA seq 646 aa AA seqDB search
MKETIESSLAEERVFEPSEDFKARANMNDPGIYRKAEEDFEGFWASVAEDIDWFEKWDKV
FEWKPPHSKWFLNGSLNASYNCLDRHLSSKGDKTAIIWEGEMENNRTFTYDELYYSTCRF
ANALKELGVKKGDIVTIYLPMIPEAVIAMLACARIGAPHSVVFAGFSHEALAQRVEDAGS
QFVITCDGYYHKGKLVDQKEKTDNALEKLDNIEHVLVVNHAANSVFFTEGRDVWWHDIEK
QVDYDCPPEHMDSEDTLFLMYTSGTTGKPKGVVHSTGGYLVGTAITAKWVFDLKDDDVYW
CTADVGWITGHSYIAYGPLLNGATVLMYEGAPDYPEKDRFWSIIENYGVTIFYTAPTAIR
TFMKWGKQLPAKHDLSSLRLLGSVGEPINPKAWLWYYEHIGDKKCPIVDTWWQTETGMIM
ITPLPGITPMKPGSAVRPFPGIKVSILDEEGNAVPEGHGGYLAIKKPWPSMIRAIYGDEE
RFIETYWSMWGKDTYMSGDGAHTDSDGYVWILGRLDDVIKVSGHRLGTMEIESSLVAHSD
VAEAAVEGKKDEIKGEVIVGYVVLETGASASDKLKEELRKHVADEIGPIARPADIIFADD
LPKTRSGKIMRRVLRAITNNTDPGDVSTLQNPDVVEELKRKVNLSD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaatagaatcgtcacttgcagaggaacgtgtttttgaaccatctgaagat
ttcaaggcccgtgccaatatgaacgatcccggtatttacaggaaggctgaagaggatttt
gaaggtttctgggcttcagttgcagaagatattgactggtttgaaaagtgggataaagtc
ttcgaatggaaacctccgcatagtaaatggttccttaatggcagtcttaacgcatcatat
aactgtcttgacaggcatctttcttcaaagggtgataagacagccattatctgggaaggg
gagatggaaaacaatcgcacctttacctatgatgaattgtattactccacatgtcgcttt
gccaatgcattgaaagaactcggggttaaaaaaggggatattgttacaatttatcttccg
atgatacccgaggctgttattgccatgcttgcctgtgcaagaatcggtgcccctcacagt
gtggtatttgccggattttcccatgaggcactcgcccaacgtgttgaggacgcaggcagt
caattcgtaattacctgtgatggttactatcacaaaggtaaactggttgaccagaaggaa
aaaaccgataatgcacttgagaaattagataacatcgagcatgtactggttgtcaatcat
gcggcaaattctgtatttttcactgagggtcgggatgtgtggtggcacgacatcgaaaaa
caggttgattatgactgtccgcctgaacacatggattccgaagatacacttttcttaatg
tataccagcggaaccacaggcaaacccaagggtgtggtccacagcaccggaggttacctt
gtcggaacagcgatcactgccaaatgggtctttgacctgaaagatgatgatgtttactgg
tgtactgcggatgtgggctggattacgggccattcctatattgcatatggtcccctgctg
aatggtgcaactgtgctgatgtatgagggagcaccggattatccagaaaaggacaggttc
tggagtataattgaaaattatggagtgacgattttttatacggcacctacagccatccgg
acattcatgaaatggggcaaacaattgcctgcaaagcatgacctttcctcgttgcggctg
ctgggaagtgtcggtgaacccatcaacccgaaggcatggctctggtactatgagcatatc
ggggacaagaaatgcccgatagttgatacatggtggcagacagaaacaggtatgataatg
atcacgccccttccggggattactccgatgaaacccggtagtgctgtgagaccgttcccg
ggaatcaaggtatccattctcgatgaagaaggaaatgcggttccagaaggacatggtgga
tatctggcaatcaagaaaccttggccgagcatgattcgtgccatttatggggatgaggaa
cgcttcattgaaacttactggagtatgtggggcaaagatacctatatgtcgggtgatggt
gctcatactgacagtgacggttatgtctggattctcggaagacttgatgatgtgataaaa
gtatccgggcacaggctcggtactatggagatcgaaagttcgcttgtagcccattcggat
gttgcggaagcagctgttgaaggaaagaaggatgaaataaaaggtgaagtgatcgttgga
tatgttgttttggaaaccggtgcttctgcaagcgataaactgaaagaggaactccgcaag
catgtagccgatgagatcggtcctattgcccgtccggcagacattatctttgctgatgac
cttccaaaaacacgtagtggaaagatcatgcgccgggtactgcgcgcgatcacaaataat
accgaccccggggatgtgtccactctgcagaatcctgatgtggttgaagaactcaaaaga
aaagttaatctatcagattaa

DBGET integrated database retrieval system