KEGG   Methanohalophilus mahii: Mmah_1592Help
Entry
Mmah_1592         CDS       T01211                                 

Definition
F420H2 dehydrogenase subunit L
Orthology
K00341  
NADH-quinone oxidoreductase subunit L [EC:1.6.5.3]
Organism
mmh  Methanohalophilus mahii
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Mmah_1592
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     Mmah_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1585613..1587625)
Genome map
AA seq 670 aa AA seqDB search
MAYENLAFLIPLLPALAFVITFFVGKKTPYGGALIPIFAIAASFLISLLITIGLLQNPDQ
VISQSYHWFAILNLGILIDPLAAVMLTMVTFVSLLIHIYSVGYMSHDPAKSRYFAETSLF
TASMLSLILSDNILQLFISWELVGLCSYLLIGFWYQKPSAASAAKKAFLTTRIGDVMFLA
GIIVLFADLFKLVNGSIPEGVYLLRFDEIFSYIPEIAAMNATILGFEVSHLTIITLLFFG
GAVGKSGQFPLHVWLPDAMEGPTTVSALIHAATMVTAGVYLVARTFPMFIAAPQSLIIVA
YVGAFTALFAATMGIVMNDLKRVLAYSTISQLGYMMLGLGMGAVIGAEAVGVSIFHLVSH
AFFKALLFLCAGSVIHAVGTHDMRELGGVAKVMPITAATMVAASLALAGFGIPGTSIGST
GFFSKDPIIENAYLFGEHAGNWFPYLFAIVAALLTSLYIFRLLFMTFAGKPRTNYGGHES
PASMTVPLSILGILALIFGAIVVEPFNKFVSGTFVNNFVNMDIPALAEVGNYELAHHAGH
EPLLILWMPVIVAVIGLLIAFVIYYQKAIDMSRFVSKDNSVYKLLYNRYYQNEIFTQLFA
VKFVYEGLAMAGYHIDRFIDGIVNVISYLTIEAGDSFRKIQTGVIQHYSMAVITGVSLLV
ILIKLVMEVF
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaaaatttagcgtttttaataccacttttacccgcactcgcctttgtaatt
accttctttgtaggtaagaaaaccccatatggcggtgcattaattccgatatttgcaata
gcagcatcatttttgatctctctactgatcactataggattgctgcagaacccggatcag
gtaattagccagtcctaccactggttcgcaattcttaatctgggtattctgatagatccg
cttgcagcggtaatgctcacaatggtgacctttgtaagtctgcttattcacatctattca
gtaggctacatgtcacatgacccggccaaatcaaggtactttgcagagacctctcttttc
actgcgtctatgctgagtctgattttgtccgacaatattctccagttgttcataagctgg
gaacttgtgggtctgtgttcttatctgctaattggtttctggtaccagaaacccagcgct
gcttcagcggcaaagaaggctttcctcaccactaggattggagatgtgatgttccttgca
ggtattattgtcctgtttgccgatcttttcaaactggtaaacggcagtatccccgaaggt
gtctacctgctccggttcgatgagatcttctcctacatccccgaaatagctgccatgaat
gcaacgattcttggctttgaggtaagccaccttacgataatcactctcctgttctttgga
ggggccgttggtaaatccggtcagttcccgctacatgtgtggctgcctgatgcaatggaa
ggtccaacaactgtttcggctcttatccatgctgcaacaatggttacagccggtgtctat
ctggttgcaagaaccttcccgatgttcatcgctgcaccacaatccctcattatagtggca
tatgtgggtgccttcaccgcactgtttgccgcaacaatgggaattgtgatgaacgatttg
aaacgggtacttgcctattctaccatcagtcagcttggttacatgatgctgggattgggt
atgggagcggtcatcggtgcagaagcagtcggtgtatctatattccacctggtcagccat
gcattcttcaaggcacttcttttcctttgtgccggtagtgtgatccatgctgtgggaacc
catgatatgagggaacttggtggcgttgcaaaggtcatgcctataacagctgcaacaatg
gtagccgcatctcttgctcttgcaggcttcggtatacccggaacctctataggaagtaca
ggtttcttcagtaaagatccaataattgaaaatgcatatctcttcggggaacatgcagga
aactggttcccatatctctttgcaatcgtggcagcactgcttacttcactttacatattc
aggttgctgttcatgacatttgccggaaagcccaggaccaattatggtgggcatgaatct
cctgcatcaatgacagttccgctttccatactgggtatacttgccctgatcttcggagct
atcgttgttgaaccattcaacaagtttgtaagcggtacctttgtgaacaactttgttaac
atggacatccctgctttggcagaggtgggtaactatgaacttgcccatcatgcaggccac
gaaccattgctcatactgtggatgcctgttatcgtggcagtgatcggtctgttgatcgcc
tttgtgatctactatcagaaagcaatagacatgagcaggtttgtttcaaaagacaactct
gtgtacaaactcctctacaaccgctattatcagaatgagatattcacccagctctttgct
gtcaagtttgtctatgaaggtcttgccatggcaggttatcacatagacaggtttattgat
ggtattgtcaatgtcatcagttacctgacaatagaggcaggggattccttcaggaagata
cagacaggagttatacaacactactcgatggctgtcattacaggagtaagtctcctggta
atattgatcaagctcgtcatggaggtcttctaa

DBGET integrated database retrieval system