KEGG   Methanohalophilus mahii: Mmah_1592Help
Entry
Mmah_1592         CDS       T01211                                 

Definition
(GenBank) F420H2 dehydrogenase subunit L
  KO
K22167  
F420H2 dehydrogenase subunit L [EC:1.12.98.3]
Organism
mmh  Methanohalophilus mahii
Brite
Enzymes [BR:mmh01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.98  With other, known, physiological acceptors
    1.12.98.3  Methanosarcina-phenazine hydrogenase
     Mmah_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1585613..1587625)
Genome map
AA seq 670 aa AA seqDB search
MAYENLAFLIPLLPALAFVITFFVGKKTPYGGALIPIFAIAASFLISLLITIGLLQNPDQ
VISQSYHWFAILNLGILIDPLAAVMLTMVTFVSLLIHIYSVGYMSHDPAKSRYFAETSLF
TASMLSLILSDNILQLFISWELVGLCSYLLIGFWYQKPSAASAAKKAFLTTRIGDVMFLA
GIIVLFADLFKLVNGSIPEGVYLLRFDEIFSYIPEIAAMNATILGFEVSHLTIITLLFFG
GAVGKSGQFPLHVWLPDAMEGPTTVSALIHAATMVTAGVYLVARTFPMFIAAPQSLIIVA
YVGAFTALFAATMGIVMNDLKRVLAYSTISQLGYMMLGLGMGAVIGAEAVGVSIFHLVSH
AFFKALLFLCAGSVIHAVGTHDMRELGGVAKVMPITAATMVAASLALAGFGIPGTSIGST
GFFSKDPIIENAYLFGEHAGNWFPYLFAIVAALLTSLYIFRLLFMTFAGKPRTNYGGHES
PASMTVPLSILGILALIFGAIVVEPFNKFVSGTFVNNFVNMDIPALAEVGNYELAHHAGH
EPLLILWMPVIVAVIGLLIAFVIYYQKAIDMSRFVSKDNSVYKLLYNRYYQNEIFTQLFA
VKFVYEGLAMAGYHIDRFIDGIVNVISYLTIEAGDSFRKIQTGVIQHYSMAVITGVSLLV
ILIKLVMEVF
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgaaaatttagcgtttttaataccacttttacccgcactcgcctttgtaatt
accttctttgtaggtaagaaaaccccatatggcggtgcattaattccgatatttgcaata
gcagcatcatttttgatctctctactgatcactataggattgctgcagaacccggatcag
gtaattagccagtcctaccactggttcgcaattcttaatctgggtattctgatagatccg
cttgcagcggtaatgctcacaatggtgacctttgtaagtctgcttattcacatctattca
gtaggctacatgtcacatgacccggccaaatcaaggtactttgcagagacctctcttttc
actgcgtctatgctgagtctgattttgtccgacaatattctccagttgttcataagctgg
gaacttgtgggtctgtgttcttatctgctaattggtttctggtaccagaaacccagcgct
gcttcagcggcaaagaaggctttcctcaccactaggattggagatgtgatgttccttgca
ggtattattgtcctgtttgccgatcttttcaaactggtaaacggcagtatccccgaaggt
gtctacctgctccggttcgatgagatcttctcctacatccccgaaatagctgccatgaat
gcaacgattcttggctttgaggtaagccaccttacgataatcactctcctgttctttgga
ggggccgttggtaaatccggtcagttcccgctacatgtgtggctgcctgatgcaatggaa
ggtccaacaactgtttcggctcttatccatgctgcaacaatggttacagccggtgtctat
ctggttgcaagaaccttcccgatgttcatcgctgcaccacaatccctcattatagtggca
tatgtgggtgccttcaccgcactgtttgccgcaacaatgggaattgtgatgaacgatttg
aaacgggtacttgcctattctaccatcagtcagcttggttacatgatgctgggattgggt
atgggagcggtcatcggtgcagaagcagtcggtgtatctatattccacctggtcagccat
gcattcttcaaggcacttcttttcctttgtgccggtagtgtgatccatgctgtgggaacc
catgatatgagggaacttggtggcgttgcaaaggtcatgcctataacagctgcaacaatg
gtagccgcatctcttgctcttgcaggcttcggtatacccggaacctctataggaagtaca
ggtttcttcagtaaagatccaataattgaaaatgcatatctcttcggggaacatgcagga
aactggttcccatatctctttgcaatcgtggcagcactgcttacttcactttacatattc
aggttgctgttcatgacatttgccggaaagcccaggaccaattatggtgggcatgaatct
cctgcatcaatgacagttccgctttccatactgggtatacttgccctgatcttcggagct
atcgttgttgaaccattcaacaagtttgtaagcggtacctttgtgaacaactttgttaac
atggacatccctgctttggcagaggtgggtaactatgaacttgcccatcatgcaggccac
gaaccattgctcatactgtggatgcctgttatcgtggcagtgatcggtctgttgatcgcc
tttgtgatctactatcagaaagcaatagacatgagcaggtttgtttcaaaagacaactct
gtgtacaaactcctctacaaccgctattatcagaatgagatattcacccagctctttgct
gtcaagtttgtctatgaaggtcttgccatggcaggttatcacatagacaggtttattgat
ggtattgtcaatgtcatcagttacctgacaatagaggcaggggattccttcaggaagata
cagacaggagttatacaacactactcgatggctgtcattacaggagtaagtctcctggta
atattgatcaagctcgtcatggaggtcttctaa

DBGET integrated database retrieval system