KEGG   Methanohalophilus mahii: Mmah_1779Help
Entry
Mmah_1779         CDS       T01211                                 

Definition
tetrahydromethanopterin S-methyltransferase, subunit B (EC:2.1.1.86)
Orthology
K00578  
tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mmh  Methanohalophilus mahii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mmah_1779
  Energy metabolism
   00680 Methane metabolism
    Mmah_1779
Enzymes [BR:mmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Mmah_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1754196..1754519
Genome map
AA seq 107 aa AA seqDB search
MSMVHVAPEVHLVLDPMSSLLAAERDDVIAYSMDPVMERIDDLDKIADDLVNSLAPDRPL
LSSFPGRENTSYSAGIYSNVFYGVIVGLVFSGILAIVIYMLSMTGGL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggtacatgttgcccctgaagtacacttagtactggacccgatgtcatccctg
cttgccgcagaacgtgatgatgtcattgcatattccatggatccagtaatggaaagaata
gatgaccttgataagatcgcagatgaccttgtgaattccctcgccccggacaggcccctt
ctcagttccttcccgggaagagaaaacacatcatacagtgccggcatatacagcaatgtg
ttctatggtgtcattgtaggactggtattctcaggaattctggcaattgtgatctacatg
cttagcatgacgggaggattgtaa

DBGET integrated database retrieval system