KEGG   Methanohalophilus mahii: Mmah_2032Help
Entry
Mmah_2032         CDS       T01211                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K18933  tyrosine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.25 4.1.1.11]
Organism
mmh  Methanohalophilus mahii
Pathway
mmh00350  Tyrosine metabolism
mmh00410  beta-Alanine metabolism
mmh00680  Methane metabolism
mmh00770  Pantothenate and CoA biosynthesis
mmh01100  Metabolic pathways
mmh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mmah_2032
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmah_2032
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmah_2032
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mmah_2032
Enzymes [BR:mmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     Mmah_2032
    4.1.1.25  tyrosine decarboxylase
     Mmah_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADE37525
JGI: Mmah_2032
UniProt: D5E8Z4
Position
complement(2010895..2011878)
Genome map
AA seq 327 aa AA seqDB search
MGDPGLFQGTFELEEQVMEMLGAMLHLPYACGYISTGGTESNIQAVRAMRNRNRSIIHPN
IVVPDSAHFSFDKVGDLSGIDIRRATLSDNLQVDTDAVNSLIDTNTVGLVGIAGTTEFGQ
VDPLETLSDIAIENGLPFHVDAAFGGFVLPFLKNKYKFDFEIAGVSSVTIDPHKMGLSTI
PSGGLLFRHSLDLDNLAVKTPYLTISSQYSLTGTRSGAAVVSTYAVMRHLGRKGYGTIVQ
RCMDMTDRLVAGARNIGIQPVIEPVMNIVALDVESPTEIQSRLYEDFGWRVSLTRNPQAL
RLVIMPHLDNEIIDMFLANLDTVVNRS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggagacccaggtctttttcagggaacatttgaactggaagaacaggtcatggagatg
ctgggtgccatgttacatcttccttatgcctgtggttatatcagtacaggaggcactgaa
tcaaatattcaggccgtaagagctatgcgtaatcgtaatagatctattatacatcctaac
attgttgttcctgattcagctcatttttcctttgataaggttggtgacctttcaggtata
gatatacgcagagcgactctttctgataatttgcaggtggatacggatgcagttaattcc
cttatagataccaatacggtaggattggtaggtatagccggtactaccgagtttggacag
gtagatcctcttgaaaccctttctgacatagctattgaaaatggtttacctttccacgta
gatgcggctttcggcggctttgtactgcctttccttaaaaataaatataaatttgatttt
gaaattgcaggtgtatcttctgtcacaatagatcctcacaaaatgggtctaagtaccatt
ccttcaggaggattgcttttccgccacagtcttgatcttgataatctggcggtaaagaca
ccttatcttactataagcagtcagtattccctgacaggtacccgtagcggagcagctgtg
gtatccacctacgcagtcatgcgtcatcttggaagaaaaggttatggtaccatcgtacaa
cgatgtatggatatgactgacaggcttgttgcaggagccaggaatataggaatccagccg
gtgatagaaccggtgatgaatatcgtggcactggatgtggagtcaccaactgaaatccaa
agcagactttacgaggattttgggtggcgcgtttctcttacgagaaatccgcaggcatta
agattggttataatgcctcatctggataatgagattatagatatgtttcttgcgaattta
gatactgttgtaaacaggtcttaa

DBGET integrated database retrieval system