KEGG   Methanohalophilus mahii: Mmah_2032Help
Entry
Mmah_2032         CDS       T01211                                 

Definition
(RefSeq) pyridoxal-dependent decarboxylase
  KO
K18933  
tyrosine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.25 4.1.1.11]
Organism
mmh  Methanohalophilus mahii
Pathway
Tyrosine metabolism
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmah_2032
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmah_2032
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mmah_2032
Enzymes [BR:mmh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     Mmah_2032
    4.1.1.25  tyrosine decarboxylase
     Mmah_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2010895..2011878)
Genome map
AA seq 327 aa AA seqDB search
MGDPGLFQGTFELEEQVMEMLGAMLHLPYACGYISTGGTESNIQAVRAMRNRNRSIIHPN
IVVPDSAHFSFDKVGDLSGIDIRRATLSDNLQVDTDAVNSLIDTNTVGLVGIAGTTEFGQ
VDPLETLSDIAIENGLPFHVDAAFGGFVLPFLKNKYKFDFEIAGVSSVTIDPHKMGLSTI
PSGGLLFRHSLDLDNLAVKTPYLTISSQYSLTGTRSGAAVVSTYAVMRHLGRKGYGTIVQ
RCMDMTDRLVAGARNIGIQPVIEPVMNIVALDVESPTEIQSRLYEDFGWRVSLTRNPQAL
RLVIMPHLDNEIIDMFLANLDTVVNRS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggagacccaggtctttttcagggaacatttgaactggaagaacaggtcatggagatg
ctgggtgccatgttacatcttccttatgcctgtggttatatcagtacaggaggcactgaa
tcaaatattcaggccgtaagagctatgcgtaatcgtaatagatctattatacatcctaac
attgttgttcctgattcagctcatttttcctttgataaggttggtgacctttcaggtata
gatatacgcagagcgactctttctgataatttgcaggtggatacggatgcagttaattcc
cttatagataccaatacggtaggattggtaggtatagccggtactaccgagtttggacag
gtagatcctcttgaaaccctttctgacatagctattgaaaatggtttacctttccacgta
gatgcggctttcggcggctttgtactgcctttccttaaaaataaatataaatttgatttt
gaaattgcaggtgtatcttctgtcacaatagatcctcacaaaatgggtctaagtaccatt
ccttcaggaggattgcttttccgccacagtcttgatcttgataatctggcggtaaagaca
ccttatcttactataagcagtcagtattccctgacaggtacccgtagcggagcagctgtg
gtatccacctacgcagtcatgcgtcatcttggaagaaaaggttatggtaccatcgtacaa
cgatgtatggatatgactgacaggcttgttgcaggagccaggaatataggaatccagccg
gtgatagaaccggtgatgaatatcgtggcactggatgtggagtcaccaactgaaatccaa
agcagactttacgaggattttgggtggcgcgtttctcttacgagaaatccgcaggcatta
agattggttataatgcctcatctggataatgagattatagatatgtttcttgcgaattta
gatactgttgtaaacaggtcttaa

DBGET integrated database retrieval system