KEGG   Methanohalophilus mahii: Mmah_2032Help
Entry
Mmah_2032         CDS       T01211                                 

Definition
pyridoxal-dependent decarboxylase
Orthology
K01592  
tyrosine decarboxylase [EC:4.1.1.25]
Organism
mmh  Methanohalophilus mahii
Pathway
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mmh00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2010895..2011878)
Genome map
AA seq 327 aa AA seqDB search
MGDPGLFQGTFELEEQVMEMLGAMLHLPYACGYISTGGTESNIQAVRAMRNRNRSIIHPN
IVVPDSAHFSFDKVGDLSGIDIRRATLSDNLQVDTDAVNSLIDTNTVGLVGIAGTTEFGQ
VDPLETLSDIAIENGLPFHVDAAFGGFVLPFLKNKYKFDFEIAGVSSVTIDPHKMGLSTI
PSGGLLFRHSLDLDNLAVKTPYLTISSQYSLTGTRSGAAVVSTYAVMRHLGRKGYGTIVQ
RCMDMTDRLVAGARNIGIQPVIEPVMNIVALDVESPTEIQSRLYEDFGWRVSLTRNPQAL
RLVIMPHLDNEIIDMFLANLDTVVNRS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggagacccaggtctttttcagggaacatttgaactggaagaacaggtcatggagatg
ctgggtgccatgttacatcttccttatgcctgtggttatatcagtacaggaggcactgaa
tcaaatattcaggccgtaagagctatgcgtaatcgtaatagatctattatacatcctaac
attgttgttcctgattcagctcatttttcctttgataaggttggtgacctttcaggtata
gatatacgcagagcgactctttctgataatttgcaggtggatacggatgcagttaattcc
cttatagataccaatacggtaggattggtaggtatagccggtactaccgagtttggacag
gtagatcctcttgaaaccctttctgacatagctattgaaaatggtttacctttccacgta
gatgcggctttcggcggctttgtactgcctttccttaaaaataaatataaatttgatttt
gaaattgcaggtgtatcttctgtcacaatagatcctcacaaaatgggtctaagtaccatt
ccttcaggaggattgcttttccgccacagtcttgatcttgataatctggcggtaaagaca
ccttatcttactataagcagtcagtattccctgacaggtacccgtagcggagcagctgtg
gtatccacctacgcagtcatgcgtcatcttggaagaaaaggttatggtaccatcgtacaa
cgatgtatggatatgactgacaggcttgttgcaggagccaggaatataggaatccagccg
gtgatagaaccggtgatgaatatcgtggcactggatgtggagtcaccaactgaaatccaa
agcagactttacgaggattttgggtggcgcgtttctcttacgagaaatccgcaggcatta
agattggttataatgcctcatctggataatgagattatagatatgtttcttgcgaattta
gatactgttgtaaacaggtcttaa

DBGET integrated database retrieval system