KEGG   Mycobacterium marinum: MMAR_0107Help
Entry
MMAR_0107         CDS       T00694                                 

Gene name
celA
Definition
cellobiohydrolase a (1,4-beta-cellobiosidase a) CelA
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmi  Mycobacterium marinum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MMAR_0107 (celA)
Enzymes [BR:mmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MMAR_0107 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
133857..134909
Genome map
AA seq 350 aa AA seqDB search
MAFVELWHYFAGVMSSAFGALARRIAPFLAVSAAAYLAFFAAPAPVVPAPPITLVDGANP
LAGQPFYVDPGSAAMVAARNATPPSPELNAIANTPQSYWLDQAFPASTVGGTVARQTGAA
QAAGAMPILTLYGIPHRDCGSYASGGFATGADYRAWIDAISSGLGSAPAAIIVEPDALAM
ADCLSADQRQERFDLVRYAVNTLTRDPAAAVYVDGGHSRWVSAEEMAARLNQVDVGHARG
FSLNISNFYTTDEEIGYGEAISGMTNGSHYVIDTGRNGVGPAPESPLNWCNPDGRALGVA
PTTATAGAHADAYLWIKRPGESDGSCGRGEPQAGHFVSQYAIDLAHNAGQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtttgtcgaattgtggcactattttgctggggtgatgtcctcagcttttggcgca
ctcgcacgccggatcgcccccttcctggccgtttcggccgccgcatacctggcgtttttt
gccgccccggcgccggtggttccggccccgccgatcaccctggtcgacggggctaacccg
ctggccgggcagcccttctacgtcgatcccggctcggccgcaatggtcgcggcgcgcaac
gccaccccgccgagtcctgagctgaacgccatcgccaacactccgcagtcctactggctc
gaccaagcgttcccggcctccaccgtcggcggcacggttgccaggcagaccggtgccgcg
caggccgccggcgccatgccgattctgacgctctatgggattccgcatcgtgactgcgga
agctacgcatcgggtggattcgcgacgggtgccgactaccgcgcatggatcgacgccatc
tcgtcgggcctgggctcggcgcccgcggcgatcatcgtcgaacccgatgcgctggccatg
gccgactgcctttcggccgaccagcgccaggaacgcttcgacttggtgcgctacgccgtc
aacacgctgacccgtgatccggccgctgccgtctacgtcgatggcgggcattcgcgctgg
gtgagcgccgaggagatggccgcccggctcaaccaggtcgatgtgggccacgcgcggggt
ttcagcctcaacatctcgaacttctacaccaccgatgaggaaatcggctacggcgaggcg
atatcggggatgacgaacggttcgcactacgtgatcgacacgggccgaaatggtgtcggc
ccggccccggagtccccgctcaactggtgcaaccctgacggccgcgccctgggcgtggcg
cccaccaccgccaccgccggcgcgcatgccgacgcgtacttgtggatcaagcgtccgggt
gagtccgacgggtcgtgcggccgcggtgagcctcaggcgggtcacttcgtcagccagtac
gccatcgacctggcccacaacgcgggccagtag

DBGET integrated database retrieval system