KEGG   Mycobacterium marinum: MMAR_0349Help
Entry
MMAR_0349         CDS       T00694                                 

Definition
oxidoreductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mmi  Mycobacterium marinum
Brite
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     MMAR_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
399344..400366
Genome map
AA seq 340 aa AA seqDB search
MSVGPKLVIGANGFLGSHVTRMLIEDGAQVRVMVRPTANTRSIDDLPVTRFHGDIFDTAV
VREAMQGCDDVYYCVVDARAWLRDPAPLFHTNVEGLRNVLDVAKNAGLRRFVFTSSYATV
DRRHGHVATEEDRIGSRRVSSYVQSRVQAEDLVMDYVAQHGLPAVAMCVSTTYGSGDWGR
TPHGAFIAGAVFGKLPFLMNGIKLEVVGVDDAARAMILAAERGRSGQRYLISERMIALKE
VVRIAADEAGVAPPQRTISVPTLYALGALGSLRARLTGKDAELSLESVRMMRAEAEVDHA
KAVRELGWQPRPVEESIREAARFWASMRKNTQGARTGQSE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgggcccaaactcgtcatcggcgccaatgggtttctcggctcgcacgtcacc
cgcatgctgatcgaggatggcgcgcaggtacgggtgatggtgcggcccaccgccaacacc
cgcagcatcgacgacctgccggtcacccgattccatggcgacatcttcgacacggccgtg
gtgcgcgaggcaatgcagggctgtgacgacgtctattactgcgtggtcgacgcgcgcgcc
tggttacgcgacccggcgccgctttttcacaccaacgtcgaaggcctgcgtaatgtcctc
gacgtcgccaagaacgccggcctgcgccgcttcgtgttcaccagcagctatgcgacggtg
gatcgtcggcatgggcacgtggcgaccgaggaggatcggatcgggtcacggcgggtctcg
tcctacgtccaatcccgggttcaggccgaagatctcgtcatggactacgtggcccaacat
ggactgcccgcggtggcgatgtgcgtctcgacgacctacggcagcggcgactggggccgc
accccacacggcgccttcatcgccggtgcggtgttcggcaagctgccgttcttgatgaac
ggcatcaagctggaagtggtgggtgtcgacgatgcggccagggcgatgatcctggccgcc
gaacgcgggcgcagcggccagcgctacctgatctccgagcggatgatcgcgttgaaagag
gtggtgcggatcgcggccgacgaggccggggtagcaccgccgcaacggacgatctcggtg
ccgacgctctatgccctgggtgcgctgggcagcttgcgggcgcggctcaccggcaaagac
gccgaactcagcctggaatcggtgcggatgatgcgcgccgaggccgaggtcgaccacgcc
aaggcggtgcgcgagttgggctggcagccgcggcccgtcgaggaatcgatacgcgaggca
gcgcggttctgggcgtcgatgcgcaagaacacccaaggcgccaggacgggacagtcggag
tag

DBGET integrated database retrieval system