KEGG   Mycobacterium marinum M: MMAR_0405Help
Entry
MMAR_0405         CDS       T00694                                 

Gene name
adhE
Definition
(GenBank) zinc-type alcohol dehydrogenase (E subunit) AdhE
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00010  Glycolysis / Gluconeogenesis
mmi00071  Fatty acid degradation
mmi00350  Tyrosine metabolism
mmi00625  Chloroalkane and chloroalkene degradation
mmi00626  Naphthalene degradation
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
mmi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_0405 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_0405 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MMAR_0405 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MMAR_0405 (adhE)
   00626 Naphthalene degradation
    MMAR_0405 (adhE)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MMAR_0405 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Mur_ligase 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ACC38872
UniProt: B2HLX3
Position
complement(470419..471561)
Genome map
AA seq 380 aa AA seqDB search
MELGLQPWLYSNMIHIRGAVLERIGSPRPYAQSRPISVVDLDLDPPGDDEVLVRIEAAGV
CHSDLSVVDGNRVRPVPMLLGHEAAGIVERVGDRVDDLAVGQRVVLVFLPRCGHCPSCAT
EGITPCAPGSATNAAGTLLGGGIRISRSGQPIYHHLGVSGFATHAVVNRASAVAVPDEVP
PQVAALLGCAVLTGGGAVLNVGKPVAGQSVAVVGLGGVGMAAVLTALTQDGVAVFGVDQL
PQKLSAAEALGASATYTPQQAAAAGVKADVVIEAAGHPAALETAIGLTAPGGRTITVGLP
PPDARISVAPLGFVAEGRSLIGSYLGSAVPSRDIPRFVSLWQSGRLPVESLVSATIRLDD
LNEAMDHLADGTAVRQIIVF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggaactgggacttcagccatggttgtattccaacatgattcacatccggggtgcggtc
ctggagcgaatcggttcgccccggccgtacgcccaatctcgtcccatcagcgtcgtcgat
ctcgatctcgatcctccgggcgacgacgaggtgctggtccgcatcgaggccgcgggcgtg
tgccactccgacctgtcggtggtcgacggcaatcgggtccggccggtgccgatgctgctg
ggccatgaggcggccggaatcgtcgagcgggtcggcgaccgggtcgacgatctggccgtc
ggccagcgggtggtgctggtgttcctgccgcgctgcggccactgcccgtcctgcgccacc
gagggcatcaccccctgcgcaccgggcagcgcgaccaacgccgccggaaccttgctcggt
ggcggcatccggatcagccgttctgggcaacccatctaccaccacctcggcgtctcgggt
ttcgcgacacatgccgtggtgaatcgggccagcgcggttgcggtgcccgacgaggtgccc
ccgcaggtggccgcactactgggatgcgcggtgttgaccggcggaggcgcggtgctcaat
gtcggcaagccggtagccgggcagtccgtcgccgtcgtcgggctcgggggggtcgggatg
gccgcggtgctcaccgccttgactcaggacggcgtcgcggtattcggcgtggaccaattg
ccccaaaagctctcggccgcggaagccctcggggccagcgccacctataccccacagcag
gccgctgccgccggcgtgaaagccgacgtggtgatcgaggcggccgggcacccggcggcg
ctggagaccgcgatcgggctgaccgcacccggcggccgcaccatcaccgtcggcctgccc
ccgccggatgcgcggatcagcgtcgcaccgttgggcttcgtcgccgaggggcgctcactc
atcggtagctacctgggctcggcggtccccagccgcgacatcccgcggttcgtgtcgttg
tggcaatccggacgcctgccggtggaatcgctggtgtccgcgacgattcggctggacgac
ctcaatgaggcgatggaccacctggccgacggcaccgccgtgcgtcaaatcatcgtgttc
tga

DBGET integrated database retrieval system