KEGG   Mycobacterium marinum M: MMAR_0520Help
Entry
MMAR_0520         CDS       T00694                                 

Definition
(GenBank) transcriptional regulatory protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00860  Porphyrin and chlorophyll metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
Module
mmi_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MMAR_0520
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MMAR_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6 TMEM213
Motif
Other DBs
NCBI-ProteinID: ACC38984
UniProt: B2HNU2
Position
complement(612578..613729)
Genome map
AA seq 383 aa AA seqDB search
MAQQKSEPLRGYRIAVTSSRRAEELCALLRRHGADVCSAPAINMIALPEDDELQGNTEAL
IANPPDILVAHTGIGFRGWVAAAEGWGLAGELVDALSVGRTISRGPKATGELRAAGLREE
WSPESESSQEVLEYLLESGVAGQRIAIQLHGAADGWDPFPEFVGGLRAAGAEVVPIRVYR
WKPTPLGGAFDQLVTEIARRQFDAVSFTSAPAAAAVLERGRELDIEEELLEALRNDVHAM
CVGPVTSRPLIRKGVPTSSPERMRLGALARHIAEELPLLGSCTVNAAGHVVDIRGTCVLV
DGSIKTLSGSGMAILRALTKRPGDVVARSELLNVLPGNGDDTHAVDTAVLRLRTALGDKN
IIATVVKRGYRLALDTQDDTACT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcaaaaatctgagccactgcggggctaccggattgcggtgacgtcttctcgc
cgggccgaggagttgtgcgcacttctgcgccgccacggtgccgacgtctgcagtgcccct
gcgatcaacatgatcgcgctgcccgaagacgacgaactccagggcaatacggaggcgttg
atcgccaacccacccgacatcctggtggcccacaccggtatcggtttccggggctgggta
gccgcggccgaggggtgggggctggccggcgaactcgttgatgcgttgtcggtaggccgg
accatatcgcgcggaccgaaggcgaccggcgagctacgcgcggcgggcttgcgcgaagaa
tggtcgccagaatcggaatcctcgcaagaagttctggaatacctgcttgaatccggggtc
gccggtcagcggatcgccattcagctacacggcgcggccgatggctgggatcccttcccc
gagtttgtcggcggcctccgcgcggcgggggccgaggtggtgcccattcgggtgtaccgc
tggaagccaacgccattgggcggcgcgttcgaccaattggtcaccgagatcgcccggcga
cagttcgacgcggtgagtttcacctctgcgcccgccgcggccgcggtgctcgagcgtggc
cgcgagctggatatcgaagaggaactgctcgaggcgctgcgcaacgacgtacacgcgatg
tgcgtcggccccgtcacctctcgccccttgatccgcaagggggtgcccacctcatcgccg
gagcgaatgcggctgggcgccttggcccgtcatatcgccgaggaacttccgctacttggc
tcctgcaccgtgaacgccgcaggccacgtcgtcgacatccgcggaacctgcgtgctcgtc
gatggctccatcaagacactgtcggggtcgggcatggcgatattgcgcgccttgaccaag
cgccccggagacgtcgtcgcccgcagcgagctgctgaatgtgcttcccggaaacggcgac
gacactcacgcggtagacaccgccgtattgcggctgcgcacggcgctgggcgacaaaaac
atcatcgcgacggtggtcaagcgtggttaccggctggcgctcgacacccaggacgacacc
gcatgcacctga

DBGET integrated database retrieval system