KEGG   Mycobacterium marinum M: MMAR_0792Help
Entry
MMAR_0792         CDS       T00694                                 

Gene name
icl
Definition
(GenBank) isocitrate lyase Icl
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00630  Glyoxylate and dicarboxylate metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01200  Carbon metabolism
Module
mmi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MMAR_0792 (icl)
Enzymes [BR:mmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MMAR_0792 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACC39252
UniProt: B2HQT2
Position
949865..951151
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQHDWDHNPRWKGITRTYTPQDVVALQGHVVEEHTLARRGSEVLWEQL
HDMDFVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALLRADEIAKVENDRSVDNWLVPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDRPFITGERTKEGFYRIKNGLEPCIARAKAYAPFSDLIWMETGTPDLKLAKQFAEG
VKAEFPDQMLAYNCSPSFNWKKHLDDETIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALAG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgttggcaccccgaagagcgctgagcagatccagcacgactgggaccacaac
ccccggtggaagggcatcacccgcacctacaccccgcaagacgtcgtcgccctgcagggc
cacgtcgtcgaggagcacaccctggcccgtcgcggctccgaggtgctctgggagcagctg
cacgacatggacttcgtcaacgcgctgggcgcgctgaccggcaacatggccgtccagcag
gtgcgtgccggcctgaaggccatctacctgtcgggttggcaggtcgccggtgacgccaac
ctttccggccacacctacccggaccagagcctgtaccccgccaactcggtgccgcaggtc
gtccgtcgtatcaacaacgcgctgctgcgcgctgacgagatcgccaaggtcgagaacgac
cgctcggtcgacaactggctggtgccgatcgtcgccgacggtgaggccggcttcggtggt
gcgctcaacgtctacgagctgcagaaggccatgatcgccgccggtgtcgccggttcgcac
tgggaggaccagctggcctcggagaagaagtgtggccacctgggcggcaaggtgctgatc
cccacccagcagcacatccggaccctgacctcggcccgtttggcagccgacgttgccgat
gtcccgaccgtggtcatcgcccggaccgacgccgaagcggccaccctgatcacctccgac
gttgacgagcgggaccgcccgttcatcaccggcgagcgcaccaaggaaggcttctaccgg
atcaagaacggtctggagccctgcatcgcccgcgccaaggcctacgcgcccttctccgac
ctgatctggatggagaccggcaccccggacctgaagctggccaagcagttcgccgagggc
gtcaaggcggagttccccgaccagatgctcgcctacaactgctcgccgtccttcaactgg
aagaagcacctcgacgacgagaccatcgccaagttccagaaggagctgggtgcgatgggc
ttcaagttccagttcatcaccctggccggcttccacgccctgaactactcgatgttcgat
ctggcctacggctacgcccgcaaccagatgtcggcctacgtcgagctgcaggagcgggag
ttcgccgccgaggagcgcggctacaccgcaaccaagcaccagcgtgaggtgggtgccggt
tacttcgaccgcatcgccaccacggtggacccgacctcgtcgaccaccgcgcttgccggt
tcgaccgaagagggccagttccactga

DBGET integrated database retrieval system