KEGG   Mycobacterium marinum M: MMAR_0814Help
Entry
MMAR_0814         CDS       T00694                                 

Gene name
gpm1
Definition
(GenBank) phosphoglycerate mutase 1 Gpm1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00010  Glycolysis / Gluconeogenesis
mmi00260  Glycine, serine and threonine metabolism
mmi00680  Methane metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
mmi01200  Carbon metabolism
mmi01230  Biosynthesis of amino acids
Module
mmi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmi_M00002  Glycolysis, core module involving three-carbon compounds
mmi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_0814 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    MMAR_0814 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMAR_0814 (gpm1)
Enzymes [BR:mmi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MMAR_0814 (gpm1)
Membrane trafficking [BR:mmi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MMAR_0814 (gpm1)
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MMAR_0814 (gpm1)
  Exosomal proteins of melanoma cells
   MMAR_0814 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACC39274
UniProt: B2HQV4
Position
976692..977447
Genome map
AA seq 251 aa AA seqDB search
MGDTGTLVLLRHGESDWNARNLFTGWVDVGLTEKGRAEAVRSGELLAEQDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPLIEKGSEFSQDADPRYANIDGGPLTECLADVVARFLPYFTDVIVGDLRAGKTVLI
VAHGNSLRALVKHLDHMSDEDIVGLNIPTGIPLRYDLDERLQPVVPGGTYLDPEAAAAGA
AAVASQGAAKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaccgggacgttggtgctgcttcgccatggcgagagcgactggaacgctcgc
aacctgttcaccggctgggtcgacgtcggcctgaccgagaagggccgggccgaggcggta
cgaagcggcgaattgctggccgaacaggatctgctgcccgatgtgctctacacctcgctg
ttgcggcgcgcgatcaccactgcgcatctggcgctggacagcgccgaccggctgtggatt
ccggtgcggcgcagctggcggctcaatgaacgtcactacggggcgctgcaggggctggac
aaggccgagaccaaggcccgctacggcgaagagcagttcatggcctggcggcgcagctat
gacactccaccgccactaatcgagaagggcagtgagttcagccaggacgctgacccccgc
tacgccaacattgacggcgggccgctgaccgaatgcctggctgacgtggtggcccggttt
ctgccctacttcaccgacgtcatcgtcggtgacctgcgggccggcaagacggtgttgatc
gtcgcgcacggcaactcgctgcgcgcgttggtcaagcatctggaccatatgtccgatgag
gacatcgtcggactcaacatcccgacgggcattccgctgcgctacgacctggacgaacgg
ctgcaaccggtggtgcccgggggtacctatctggacccggaggcggccgccgcgggggct
gccgcggtggcgagtcaaggcgcggcaaaagcctga

DBGET integrated database retrieval system