KEGG   Mycobacterium marinum: MMAR_0814Help
Entry
MMAR_0814         CDS       T00694                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_0814 (gpmA)
   01230 Biosynthesis of amino acids
    MMAR_0814 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_0814 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MMAR_0814 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMAR_0814 (gpmA)
Enzymes [BR:mmi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MMAR_0814 (gpmA)
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MMAR_0814 (gpmA)
  Exosomal proteins of melanoma cells
   MMAR_0814 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976692..977447
Genome map
AA seq 251 aa AA seqDB search
MGDTGTLVLLRHGESDWNARNLFTGWVDVGLTEKGRAEAVRSGELLAEQDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPLIEKGSEFSQDADPRYANIDGGPLTECLADVVARFLPYFTDVIVGDLRAGKTVLI
VAHGNSLRALVKHLDHMSDEDIVGLNIPTGIPLRYDLDERLQPVVPGGTYLDPEAAAAGA
AAVASQGAAKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaccgggacgttggtgctgcttcgccatggcgagagcgactggaacgctcgc
aacctgttcaccggctgggtcgacgtcggcctgaccgagaagggccgggccgaggcggta
cgaagcggcgaattgctggccgaacaggatctgctgcccgatgtgctctacacctcgctg
ttgcggcgcgcgatcaccactgcgcatctggcgctggacagcgccgaccggctgtggatt
ccggtgcggcgcagctggcggctcaatgaacgtcactacggggcgctgcaggggctggac
aaggccgagaccaaggcccgctacggcgaagagcagttcatggcctggcggcgcagctat
gacactccaccgccactaatcgagaagggcagtgagttcagccaggacgctgacccccgc
tacgccaacattgacggcgggccgctgaccgaatgcctggctgacgtggtggcccggttt
ctgccctacttcaccgacgtcatcgtcggtgacctgcgggccggcaagacggtgttgatc
gtcgcgcacggcaactcgctgcgcgcgttggtcaagcatctggaccatatgtccgatgag
gacatcgtcggactcaacatcccgacgggcattccgctgcgctacgacctggacgaacgg
ctgcaaccggtggtgcccgggggtacctatctggacccggaggcggccgccgcgggggct
gccgcggtggcgagtcaaggcgcggcaaaagcctga

DBGET integrated database retrieval system