KEGG   Mycobacterium marinum: MMAR_0845Help
Entry
MMAR_0845         CDS       T00694                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mmi  Mycobacterium marinum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MMAR_0845 (hemB)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MMAR_0845 (hemB)
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MMAR_0845 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010281..1011264
Genome map
AA seq 327 aa AA seqDB search
MGAYPRQRPRRLRSTAAMRRLVAQTSLEPRHLVLPMFVADGIEEPRPIASMPGVMQHTRD
SLRSAAADAVSAGVGGLMLFGVPRDTSKDPVGSAGTDPDGILNAALRDLAKDLGDATVLM
ADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAQAGAHVVGPSGMMDGQVGAI
RDGLDEAGHADVVILAYAAKFASAFYGPFREAVSCSLSGDRRTYQQEPGNMREALREVEL
DLDEGADIVMIKPALGYLDVVAAAADISPVPVAAYQVSGEYAMICAAAANSWIDQRAAAL
ESLTSIRRAGADIVLTYWAADAASWLS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctacccgcggcagcggccgcgccggctccgctcgaccgcggcgatgcgccgc
ttggtagcgcagacctccttggagccaaggcatttggtgctgccgatgttcgtcgccgac
ggtatcgaagagccgcgcccgatcgcgtcgatgccgggggtgatgcaacacacccgcgat
tcgctgcgcagcgccgccgcggacgccgtttccgccggggtgggcggcctgatgttgttc
ggggtgccccgtgacacgtcgaaggatcccgtcggctcggccggtaccgatcctgacggc
attctcaacgcggccctgcgcgacttggccaaggatctcggggacgcgacggtgctgatg
gccgacacctgcctggacgagttcaccgaccacgggcactgtggggtgctcgatgaccgg
ggccgtgtcgacaacgacgcgaccgtggcccgctacgtcgaattggcggtcgcgcaggcg
caggccggcgcccatgtggtgggaccgagcgggatgatggacggccaggtgggtgcgatc
cgcgacgggctggacgaggccggccacgccgacgtggtgattttggcctacgcggccaag
ttcgcctcggcgttctatggccccttccgagaagcggtgagctgcagcctgtccggggat
cggcgcacctaccagcaggaaccgggcaacatgcgggaggcgctgcgcgaggtcgagctg
gatctggacgaaggtgccgacatcgtgatgatcaaacccgctttggggtatctggacgtc
gtcgccgcggccgcagacatttccccggtgccggtggccgcctatcaggtctcgggggag
tacgcgatgatttgtgcggcggcggccaacagctggatcgaccagcgggccgcggccctg
gagtcgctgaccagcatccggcgtgccggggccgatatcgtgctcacctattgggccgcc
gatgcagcgagttggctgtcgtga

DBGET integrated database retrieval system