KEGG   Mycobacterium marinum M: MMAR_0956Help
Entry
MMAR_0956         CDS       T00694                                 

Gene name
recD
Definition
exodeoxyribonuclease V (alpha chain), RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mmi  Mycobacterium marinum M
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167598..1169361)
Genome map
AA seq 587 aa AA seqDB search
MTIDVVDPADWRQAASASGPLRTFNEAGVIDAADVHVAQRLAAMSGESDPVVLLAIAFVV
RALRGGSVCVDLSTIEAQVGIADLPWPAAGEWLAAVRASPLVGSPAVLRLHEDNLVYLDR
YWREEQQVADDILALLAARASASGPAIEVNRLFPPGYEEQRAAAKIALAQGLTVLTGGPG
TGKTTTVARLLALFAEQAQLAGKARLRIALAAPTGKAAARLHEAVQSQIDKLDAIDQQRV
RGLQATTLHRLLGSRPDTSSRFRHHRGNRLPHDVIVIDETSMVSLTMMARLLEAVRPQTR
LLLVGDPDQLASVEAGAVLADLVDGLGARHDTHVAALRRLHRFGESIGQLAAAIRGGDAD
RVVEILRAGDDHIEWINAADPTPQLRNVLLPHALELRRAGALGDTAAALATLDEQRLLCA
HRRGPYGIAHWNHQVQRWLTEATGEPIWSSWYAGRPVLVTANDYGLGVYNGDTGVAVLDG
TNRAAAPGALRVLIAGAQEPLKFATSRLSDVETMHAMTIHKSQGSQADDVTVLLPPADSR
LLTRELFYTAVTRAARKVRIVGPECDVRAAIARRAIRATGLRSRLQP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacgttgtcgacccggcggactggcggcaggcggcgagcgcgtccggaccg
ctgcggacgttcaatgaagccggtgtcatcgatgcggccgatgtccatgtcgcgcaacgc
cttgcggccatgtctggcgagtccgacccggtggtgttgctggccatcgcgttcgtggtg
cgcgcgctgcggggcggttcggtgtgtgtcgacctgtccaccatcgaggcacaagtcggg
atcgccgacctcccctggccggcggccggcgaatggctggccgcggttcgggccagccca
ctggtcgggtcaccggcggtgctgcgcctgcacgaggacaatctggtctatctggaccgg
tactggcgcgaagaacagcaggtcgccgacgacatcctggccctgctggccgcccgggcc
agcgcatcgggcccggctatcgaggtcaaccggctgtttccacccggctacgaagagcag
cgcgcggccgccaagattgcgctggcgcagggcttgacggtgctgaccggtggaccgggg
accggcaaaaccaccacggtggcgcggctgttggccctattcgccgagcaggcacagctc
gccggcaaggcgcgactgcgcattgcactggccgcaccgaccggcaaggccgcggccaga
ctgcacgaggcggtgcagtcgcagatcgacaaactcgatgccatcgatcagcaacgggtt
cgtgggctacaggcgaccacattgcaccggctactgggcagccggcccgacacctcatca
cggtttcgccatcatcgcggcaaccggctgccgcatgacgtgatcgtcatcgatgagacg
tcgatggtgtcgctgaccatgatggctcgcctgctcgaagcggtgcgtccgcagacgcgg
ctgcttcttgtcggcgatcccgaccaactggcgtcggtggaggcgggcgcggtgttggcc
gacctggtggacgggctgggcgcgcgccacgacacccacgtcgcggcactgcgcagactg
catcggttcggcgagtcgatcggccagttggcggcggccatccgcggcggcgacgccgac
cgggttgtcgagatcttgcgggcgggcgacgaccacatcgagtggatcaacgccgccgac
ccgaccccgcagctgcgcaatgtgctgcttccacacgcccttgagcttcgacgcgccggc
gcgctcggtgataccgcggccgcgttggcaacactcgacgagcaacggctgctgtgcgca
caccggcgtggaccgtatggaatcgcgcactggaaccaccaagtgcagagatggctcacc
gaagcaacgggcgagccgatctggtcgagctggtatgccggacggccggtgttggtgacc
gccaacgactatgggctcggcgtgtacaacggcgacaccggggtggccgtcctggatggc
acgaaccgcgccgcggctccgggcgcgctgcgggtcctcatcgccggcgcgcaggagccg
ctgaagttcgcgaccagccgactatctgatgtggaaaccatgcatgccatgacgatccac
aagagccagggcagtcaagccgacgacgtgaccgtgctgctgccgccggcggattcccgg
ttgctgacccgggaactgttctacacggcggtcacccgggccgcccgcaaggtgcgcatc
gtcgggccggagtgcgacgtacgggccgcgatcgcgcgccgggcgatccgggcgaccggg
ttgcgttcccgattgcagccgtga

DBGET integrated database retrieval system