KEGG   Mycobacterium marinum: MMAR_0956Help
Entry
MMAR_0956         CDS       T00694                                 

Gene name
recD
Definition
exodeoxyribonuclease V (alpha chain), RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mmi  Mycobacterium marinum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MMAR_0956 (recD)
Enzymes [BR:mmi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MMAR_0956 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167598..1169361)
Genome map
AA seq 587 aa AA seqDB search
MTIDVVDPADWRQAASASGPLRTFNEAGVIDAADVHVAQRLAAMSGESDPVVLLAIAFVV
RALRGGSVCVDLSTIEAQVGIADLPWPAAGEWLAAVRASPLVGSPAVLRLHEDNLVYLDR
YWREEQQVADDILALLAARASASGPAIEVNRLFPPGYEEQRAAAKIALAQGLTVLTGGPG
TGKTTTVARLLALFAEQAQLAGKARLRIALAAPTGKAAARLHEAVQSQIDKLDAIDQQRV
RGLQATTLHRLLGSRPDTSSRFRHHRGNRLPHDVIVIDETSMVSLTMMARLLEAVRPQTR
LLLVGDPDQLASVEAGAVLADLVDGLGARHDTHVAALRRLHRFGESIGQLAAAIRGGDAD
RVVEILRAGDDHIEWINAADPTPQLRNVLLPHALELRRAGALGDTAAALATLDEQRLLCA
HRRGPYGIAHWNHQVQRWLTEATGEPIWSSWYAGRPVLVTANDYGLGVYNGDTGVAVLDG
TNRAAAPGALRVLIAGAQEPLKFATSRLSDVETMHAMTIHKSQGSQADDVTVLLPPADSR
LLTRELFYTAVTRAARKVRIVGPECDVRAAIARRAIRATGLRSRLQP
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacgttgtcgacccggcggactggcggcaggcggcgagcgcgtccggaccg
ctgcggacgttcaatgaagccggtgtcatcgatgcggccgatgtccatgtcgcgcaacgc
cttgcggccatgtctggcgagtccgacccggtggtgttgctggccatcgcgttcgtggtg
cgcgcgctgcggggcggttcggtgtgtgtcgacctgtccaccatcgaggcacaagtcggg
atcgccgacctcccctggccggcggccggcgaatggctggccgcggttcgggccagccca
ctggtcgggtcaccggcggtgctgcgcctgcacgaggacaatctggtctatctggaccgg
tactggcgcgaagaacagcaggtcgccgacgacatcctggccctgctggccgcccgggcc
agcgcatcgggcccggctatcgaggtcaaccggctgtttccacccggctacgaagagcag
cgcgcggccgccaagattgcgctggcgcagggcttgacggtgctgaccggtggaccgggg
accggcaaaaccaccacggtggcgcggctgttggccctattcgccgagcaggcacagctc
gccggcaaggcgcgactgcgcattgcactggccgcaccgaccggcaaggccgcggccaga
ctgcacgaggcggtgcagtcgcagatcgacaaactcgatgccatcgatcagcaacgggtt
cgtgggctacaggcgaccacattgcaccggctactgggcagccggcccgacacctcatca
cggtttcgccatcatcgcggcaaccggctgccgcatgacgtgatcgtcatcgatgagacg
tcgatggtgtcgctgaccatgatggctcgcctgctcgaagcggtgcgtccgcagacgcgg
ctgcttcttgtcggcgatcccgaccaactggcgtcggtggaggcgggcgcggtgttggcc
gacctggtggacgggctgggcgcgcgccacgacacccacgtcgcggcactgcgcagactg
catcggttcggcgagtcgatcggccagttggcggcggccatccgcggcggcgacgccgac
cgggttgtcgagatcttgcgggcgggcgacgaccacatcgagtggatcaacgccgccgac
ccgaccccgcagctgcgcaatgtgctgcttccacacgcccttgagcttcgacgcgccggc
gcgctcggtgataccgcggccgcgttggcaacactcgacgagcaacggctgctgtgcgca
caccggcgtggaccgtatggaatcgcgcactggaaccaccaagtgcagagatggctcacc
gaagcaacgggcgagccgatctggtcgagctggtatgccggacggccggtgttggtgacc
gccaacgactatgggctcggcgtgtacaacggcgacaccggggtggccgtcctggatggc
acgaaccgcgccgcggctccgggcgcgctgcgggtcctcatcgccggcgcgcaggagccg
ctgaagttcgcgaccagccgactatctgatgtggaaaccatgcatgccatgacgatccac
aagagccagggcagtcaagccgacgacgtgaccgtgctgctgccgccggcggattcccgg
ttgctgacccgggaactgttctacacggcggtcacccgggccgcccgcaaggtgcgcatc
gtcgggccggagtgcgacgtacgggccgcgatcgcgcgccgggcgatccgggcgaccggg
ttgcgttcccgattgcagccgtga

DBGET integrated database retrieval system