KEGG   Mycobacterium marinum: MMAR_0987Help
Entry
MMAR_0987         CDS       T00694                                 

Definition
carbohydrate kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_0987
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_0987
   00052 Galactose metabolism
    MMAR_0987
   00500 Starch and sucrose metabolism
    MMAR_0987
   00520 Amino sugar and nucleotide sugar metabolism
    MMAR_0987
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MMAR_0987
   00524 Butirosin and neomycin biosynthesis
    MMAR_0987
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MMAR_0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1201847..1202755
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKVAVGLADADGALVHTAQVPTPARCAAEQVWAAVAEAIAEALRVADATV
AAVGIASAGPVDLDSGTVSPINIGSWRGFPLRDRVAAMVPDVPVRLGGDGVCMALGEHWL
GAGRGARFLLGMVVSTGVGGGLVLGGVPYPGRTGNAGHVGHVVVDQDGLRCSCGGRGCVE
TIAAGPSMVRWARANGWSARPEAGARELAAAAAAGDAVALAAFRRGTRGLAAMIASVGAV
CDLDRVVIGGGVAKAGRLLFDPLRAALADYLGLDFLAGLRVVPAELGGQAGLVGAARLAG
LG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccctctgtctggacatcggcggcaccaaggtcgccgtcgggctggccgacgcc
gacggcgcgctggtgcacaccgcccaggtgccgaccccggcgcgatgcgcggccgagcag
gtctgggccgcggtcgccgaggcgatcgccgaggcattgcgggtggccgacgccacggtg
gctgcggtgggcatcgcctcggccgggccggtcgacctggatagcgggacggtcagcccg
atcaatatcggctcctggcgcggcttcccgctgcgagaccgggttgcggccatggtgccc
gatgtgccggtgcggctgggcggcgatggggtctgcatggcgctcggcgagcactggctg
ggtgcgggacggggagcacgtttcctgttgggcatggtggtgtccaccggtgtcggcggg
gggctggtgctcggcggcgtcccgtatccgggccgcaccggcaacgcgggacacgtgggg
catgtcgtggtcgatcaggatggcctgcggtgttcctgcggtggccgtggctgtgtcgag
acgatcgccgctggcccgtcgatggttcgatgggctcgggccaacggttggtcggcgcgg
cccgaagcgggcgccagggaattggcggccgcggcagccgccggagatgccgtggcgctg
gcggcctttcgccggggcacccgtggcctggccgccatgatcgcctcggtgggcgcggtg
tgcgacctcgaccgggttgtcatcgggggaggggtcgccaaagccgggcgcctgttattc
gacccgctgcgcgcggcattggccgactacctcgggctggacttcttggccggcctgcgc
gttgtgcccgccgagctaggcggacaggccggtctggtcggtgccgcccgccttgccggg
ctcggctag

DBGET integrated database retrieval system