KEGG   Mycobacterium marinum M: MMAR_0987Help
Entry
MMAR_0987         CDS       T00694                                 

Definition
(GenBank) carbohydrate kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00010  Glycolysis / Gluconeogenesis
mmi00052  Galactose metabolism
mmi00500  Starch and sucrose metabolism
mmi00520  Amino sugar and nucleotide sugar metabolism
mmi00521  Streptomycin biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
mmi01200  Carbon metabolism
Module
mmi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_0987
   00052 Galactose metabolism
    MMAR_0987
   00500 Starch and sucrose metabolism
    MMAR_0987
   00520 Amino sugar and nucleotide sugar metabolism
    MMAR_0987
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MMAR_0987
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MMAR_0987
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MMAR_0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase FtsA FGGY_N MDMPI_N
Motif
Other DBs
NCBI-ProteinID: ACC39443
UniProt: B2HSI5
Position
1201847..1202755
Genome map
AA seq 302 aa AA seqDB search
MLTLCLDIGGTKVAVGLADADGALVHTAQVPTPARCAAEQVWAAVAEAIAEALRVADATV
AAVGIASAGPVDLDSGTVSPINIGSWRGFPLRDRVAAMVPDVPVRLGGDGVCMALGEHWL
GAGRGARFLLGMVVSTGVGGGLVLGGVPYPGRTGNAGHVGHVVVDQDGLRCSCGGRGCVE
TIAAGPSMVRWARANGWSARPEAGARELAAAAAAGDAVALAAFRRGTRGLAAMIASVGAV
CDLDRVVIGGGVAKAGRLLFDPLRAALADYLGLDFLAGLRVVPAELGGQAGLVGAARLAG
LG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccctctgtctggacatcggcggcaccaaggtcgccgtcgggctggccgacgcc
gacggcgcgctggtgcacaccgcccaggtgccgaccccggcgcgatgcgcggccgagcag
gtctgggccgcggtcgccgaggcgatcgccgaggcattgcgggtggccgacgccacggtg
gctgcggtgggcatcgcctcggccgggccggtcgacctggatagcgggacggtcagcccg
atcaatatcggctcctggcgcggcttcccgctgcgagaccgggttgcggccatggtgccc
gatgtgccggtgcggctgggcggcgatggggtctgcatggcgctcggcgagcactggctg
ggtgcgggacggggagcacgtttcctgttgggcatggtggtgtccaccggtgtcggcggg
gggctggtgctcggcggcgtcccgtatccgggccgcaccggcaacgcgggacacgtgggg
catgtcgtggtcgatcaggatggcctgcggtgttcctgcggtggccgtggctgtgtcgag
acgatcgccgctggcccgtcgatggttcgatgggctcgggccaacggttggtcggcgcgg
cccgaagcgggcgccagggaattggcggccgcggcagccgccggagatgccgtggcgctg
gcggcctttcgccggggcacccgtggcctggccgccatgatcgcctcggtgggcgcggtg
tgcgacctcgaccgggttgtcatcgggggaggggtcgccaaagccgggcgcctgttattc
gacccgctgcgcgcggcattggccgactacctcgggctggacttcttggccggcctgcgc
gttgtgcccgccgagctaggcggacaggccggtctggtcggtgccgcccgccttgccggg
ctcggctag

DBGET integrated database retrieval system