KEGG   Mycobacterium marinum: MMAR_1004Help
Entry
MMAR_1004         CDS       T00694                                 

Gene name
echA5
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmi  Mycobacterium marinum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MMAR_1004 (echA5)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MMAR_1004 (echA5)
   00650 Butanoate metabolism
    MMAR_1004 (echA5)
  Lipid metabolism
   00071 Fatty acid degradation
    MMAR_1004 (echA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MMAR_1004 (echA5)
   00310 Lysine degradation
    MMAR_1004 (echA5)
   00360 Phenylalanine metabolism
    MMAR_1004 (echA5)
   00380 Tryptophan metabolism
    MMAR_1004 (echA5)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMAR_1004 (echA5)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MMAR_1004 (echA5)
   00281 Geraniol degradation
    MMAR_1004 (echA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MMAR_1004 (echA5)
   00627 Aminobenzoate degradation
    MMAR_1004 (echA5)
   00930 Caprolactam degradation
    MMAR_1004 (echA5)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MMAR_1004 (echA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1229534..1230307
Genome map
AA seq 257 aa AA seqDB search
MSDLVQVERNGPVTTVIINRPQARNAVNGPTAAALYSAFAEFDRDESASVAVLCGNGGTF
CAGADLKAFGTAEANAVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVA
EQDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRAVQADEALAIGLANRVVP
NGQARQAAEELAAQLAALPQQCLRSDRLSALQQWGLPESAALDLEFASISRVAAEALEGA
GRFAAGAGRHGAQASHD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatctagtacaggtcgagcgcaacggtccggtaaccaccgtgatcatcaaccgg
ccgcaggcgcgcaacgcggtcaacggtccgacggctgccgcgctctactcggcattcgcc
gaattcgaccgggatgaatccgcttcggtggccgtcttgtgcggaaatggcggaaccttc
tgcgcgggagcggatttgaaggctttcggcaccgcggaggccaacgccgtgcaccggacg
ggtccgggcccgatgggcccgtcgcgaatgatgctgtccaagccggtgatcgccgcggtc
agtggctacgcggtggccgggggactggagctggcgttgtggtgcgatctgcgggtggcc
gaacaggacgcggtattcggcgtgttctgtcggcggtggggcgtgccgctcatcgacggc
ggcacggtgcggctgccgcggctgatcggccacagccgggcgatggacatgatccttacc
ggtcgtgcggtgcaggccgacgaggcgctggcaatcgggttggcgaatcgggtggtaccc
aacggacaagcccggcaagcagccgaggagttggcggcccagctggcggcgctgccacaa
caatgcctgcgatcggatcgcctctcagcgcttcagcaatggggcttgcccgaatccgcg
gctctcgatctggaattcgccagcatttcccgagtggccgccgaggcgttggagggggcc
gggcgcttcgccgcgggtgccggtcgccatggcgcccaggcgagccacgactga

DBGET integrated database retrieval system