KEGG   Mycobacterium marinum M: MMAR_1140Help
Entry
MMAR_1140         CDS       T00694                                 

Gene name
choD
Definition
cholesterol oxidase ChoD
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mmi  Mycobacterium marinum M
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mmi00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368051..1369796
Genome map
AA seq 581 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFSDAEFAKTSWDLRKFLWAPKL
GCYGIQRIHPLKNVMILAGAGVGGGSLNYANTLYVPPDPFFNDQQWKHITDWRDELMPHY
QQAQRMLGVVKNPTFTDADRIVKEVADEMGFGDTWVPTPVGVFFGPDGTKTPGKTVPDPY
FGGAGPARTGCTECGECMTGCRHGAKNTLVKNYLGLAESAGAEVIPMTTVKGFEQRPDGL
WEVRTVRTGSWARRDRRTFTASYLILAAGTWGTQHLLFKMRDKGKLPRLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTPDTHVEPVRYGKGSNAMGLLQTLMTDGSG
PSGTDVARWRQLLDQAGESPRRMFRLINPRQWSERTVIALVMQHLDNSITTFTKRGKLGI
RWYSSKQGHGEPNPTWIPVGNQVTRRIAEKIDGVAGGTWGELFNIPLTAHFLGGAVIGDN
PDSGVIDPYHRVYGYPTMFVVDGAAISANLGVNPSLSITAQAERAASLWPNKGQNDERPL
QGDGYSRLSPVQPEHPVVPADAPGALRWLPIDPVSRVSSAG
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtcttgattatcggttcgggtttcgggggcagtgtgagtgcg
ctgcgcctgacggagaaaggctaccgggtcggcgtgctggaggccggtcggcgcttcagt
gatgccgaattcgccaagacatcctgggatctgcgcaaattcctgtgggcgcccaagctg
ggttgctacggcatccagcgcatccacccgctgaaaaacgtgatgatcctggccggcgcg
ggggtgggcggcggatcgctgaactatgccaacacgctctacgttccgccggacccattc
ttcaacgaccagcagtggaaacacatcaccgactggcgcgacgagctgatgccgcactac
cagcaggcgcagcggatgctgggcgtggtgaaaaacccgacgttcaccgacgcggaccgc
atcgtcaaggaagtcgccgacgagatgggattcggtgacacctgggtgcccaccccggtc
ggggtgttcttcggtcccgacggcaccaagacgccgggcaagacggtgcccgacccctac
ttcggcggtgccggccccgcgcgaaccggctgcaccgaatgcggcgagtgcatgaccggc
tgtcgccatggcgccaagaacaccctggtaaagaactaccttggtctggcggaatcggct
ggtgccgaggtgattccgatgaccacggtgaagggcttcgagcagcggccggacgggttg
tgggaggttcggacggttcgcaccggcagttgggcacgacgggaccggcgtaccttcacc
gcctcgtacctgatcttggccgccggtacctgggggacccagcatctgctgttcaagatg
cgcgacaagggcaagttgcccaggctctccaagcggctgggcgtgctgacccgaaccaac
tccgaatccatcgtcggcgccgcgacgttgaaggtgaatccggacctggacctgacccac
ggggtggcgatcacgtcgtcgattcacccgacgccggatacccacgtcgagccggtccgc
tacggcaagggctccaacgcgatggggttgttgcagacgctgatgaccgacggttccggt
cccagcggcaccgacgtggcgcgttggcgccagctgctcgaccaggccggggagagtccg
cgcaggatgttccggctgatcaacccccggcagtggagcgagcgcacggtgatcgcgctg
gtcatgcagcacctggacaactcgatcaccacgttcaccaagcgcggcaagttgggcatc
cgctggtattccagcaagcaggggcacggcgaaccgaacccgacctggatcccggtcggc
aaccaggtgacccgccgcattgccgagaagatcgacggggtggccggcggtacctggggt
gagttgttcaacatcccgctgaccgcgcacttcctgggtggtgcggtgatcggcgacaac
cccgacagcggggtcatcgacccgtatcaccgcgtctacggctacccgaccatgttcgtg
gtcgacggtgccgcgatctcggcgaaccttggtgtcaacccctcgctgtccatcaccgca
caagccgagcgtgccgcctcgctctggcccaacaagggccaaaacgatgagcggccgctg
cagggcgacggctacagtcggctgtccccggttcagccggaacacccggtggtgcccgcc
gacgcgcccggcgcgctgcgctggctgcccatcgatccggtcagccgggtcagcagcgcg
ggctga

DBGET integrated database retrieval system