KEGG   Mycobacterium marinum: MMAR_1202Help
Entry
MMAR_1202         CDS       T00694                                 

Gene name
sdhD
Definition
succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mmi  Mycobacterium marinum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_1202 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMAR_1202 (sdhD)
   00650 Butanoate metabolism
    MMAR_1202 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MMAR_1202 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459762..1460229)
Genome map
AA seq 155 aa AA seqDB search
MSAPDHQLGRGEHAPVLQRSHDRPASLDNPRSPRRRAGMPNFEKYAWLFMRFSGVVLVFL
ALGHLFIGLMWENGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGGNGLRVIIDDYSR
KDSTRFWLNSLLVVSIVFTLALGSYVLLTFDANIS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccagaccaccagctcggccggggcgagcacgctccggtgttgcagcgcagc
cacgaccggcccgccagcctggacaatccacgttcgccgcgtcgccgcgccggcatgccc
aacttcgagaaatacgcctggctgttcatgcgattctccggcgtggtgctggtgttcctg
gcgctggggcacttgttcatcgggctgatgtgggaaaacggggtctaccgaatcgacttc
aactacgtggcgcagcgctggtcgtccccgttctggcagacctgggatctgctgctgttg
tggctggcacagttgcacggcggcaacgggctgcgagtcatcatcgacgactacagccgc
aaggattccactcgattctggctgaattcgctgctggtggtgtcgatcgtgttcacgctg
gccctaggcagctacgtgctgttgacgttcgacgcgaacatctcctga

DBGET integrated database retrieval system