KEGG   Mycobacterium marinum M: MMAR_1202Help
Entry
MMAR_1202         CDS       T00694                                 

Gene name
sdhD
Definition
succinate dehydrogenase (hydrophobic membrane anchor subunit) SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mmi  Mycobacterium marinum M
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:mmi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmi00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mmi00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mmi00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1459762..1460229)
Genome map
AA seq 155 aa AA seqDB search
MSAPDHQLGRGEHAPVLQRSHDRPASLDNPRSPRRRAGMPNFEKYAWLFMRFSGVVLVFL
ALGHLFIGLMWENGVYRIDFNYVAQRWSSPFWQTWDLLLLWLAQLHGGNGLRVIIDDYSR
KDSTRFWLNSLLVVSIVFTLALGSYVLLTFDANIS
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccagaccaccagctcggccggggcgagcacgctccggtgttgcagcgcagc
cacgaccggcccgccagcctggacaatccacgttcgccgcgtcgccgcgccggcatgccc
aacttcgagaaatacgcctggctgttcatgcgattctccggcgtggtgctggtgttcctg
gcgctggggcacttgttcatcgggctgatgtgggaaaacggggtctaccgaatcgacttc
aactacgtggcgcagcgctggtcgtccccgttctggcagacctgggatctgctgctgttg
tggctggcacagttgcacggcggcaacgggctgcgagtcatcatcgacgactacagccgc
aaggattccactcgattctggctgaattcgctgctggtggtgtcgatcgtgttcacgctg
gccctaggcagctacgtgctgttgacgttcgacgcgaacatctcctga

DBGET integrated database retrieval system