KEGG   Mycobacterium marinum: MMAR_1205Help
Entry
MMAR_1205         CDS       T00694                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmi  Mycobacterium marinum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MMAR_1205 (deoA)
Enzymes [BR:mmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MMAR_1205 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1461263..1462564
Genome map
AA seq 433 aa AA seqDB search
MTDFEFDAPTVIRIKRDGGRLSDAAIDWVIDAYTEGRVAPEQMSALLMAIVLQGMDRGET
ARWTSAMLASGPRLDFSDLRAGGAPLVTVDKHSTGGVGDKITLPLVPVVVACGGTVPQAS
GRGLGHTGGTLDKLESISGFTATLSNQQVREQLCDVGAAIFAAGELAPADAKLYALRDIT
GTVESLPLIASSIMSKKLAEGAGALVLDVKVGSGAFLKSETQSRELAHTMVELGAAHGVP
TRALLTDMNCPLGSTVGNALEVAEALEVLDGGGPPDVVELTVRLAAEMLDLVGIDGLDPA
ETLRDGSAMDRFRRLIAAQGGELAKPLPIGAHSETVRAGRGGTMGDIDAMAVGLAAWRLG
AGRSRPGARVQHGAGIRIHRRPGEPVAAGEPLFTLYTDTPERFGAAVAELAAGFSVADSA
PTTRPLIIDRISR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgacttcgagttcgatgcaccgacggtgatccgcatcaagcgtgacggcggtcgg
ctgtccgatgccgctatcgactgggtgatcgacgcctacaccgagggccgggtcgcgccc
gaacagatgtcggcgctgctgatggcgattgtcttgcagggcatggaccgaggtgagacc
gcccggtggacatcggcgatgctggcgtcgggcccgcggttggacttctccgatctgcgc
gcgggcggtgcgccgttggtgaccgtggacaagcactccaccggcggggtgggggacaag
atcacgctgccgctggtgcctgtcgtcgtcgcctgtgggggcactgtcccgcaggcgtcg
ggtcgtgggctcggccacaccggcggcaccctggacaaactggaatccatcagtggattc
accgcgacgctgtccaaccagcaggtgcgtgaacagctttgcgatgtcggcgccgcgatc
ttcgccgctggtgagctggcgcccgccgatgccaagctgtacgcgctgcgcgacatcacc
ggcaccgtggaatcgctgccgttgattgccagctcgatcatgagcaagaagctggccgag
ggggcgggcgcgctggtgctggacgtgaaggtcggctcgggagcgtttctgaaatccgaa
acccaatcacgtgaattggcacacaccatggtcgagctgggcgcggcacacggcgtgccc
acccgagcgctgctgaccgacatgaactgtccgttgggctcgaccgtcggtaatgcgctc
gaggtggccgaggcgctggaggtgctcgacggcggtgggccgcccgacgtggtggaactg
acggtgcggttggccgccgagatgctcgacctggtcgggatcgatggcctcgacccggcc
gagacgctgcgcgacggctccgcgatggaccggtttcgccggctgatcgcggcccagggg
ggagagttggccaaaccgttgccgattggtgcgcattcggaaaccgtccgggccggccgc
ggcggcacaatgggcgacatcgatgcgatggcggtggggttggcggcctggcggctcggc
gcgggcaggtcccgccccggtgcacgggtccagcacggcgctggcattcggatccatcgg
cgaccgggggagccggtggcggccggtgagcccttgttcacgctctataccgacaccccc
gagcggttcggcgccgcggtagccgagctggccgccggcttcagcgtcgctgacagcgcg
ccgaccactcggcctctcatcattgatcggatcagccgatga

DBGET integrated database retrieval system