KEGG   Mycobacterium marinum M: MMAR_1548Help
Entry
MMAR_1548         CDS       T00694                                 

Gene name
glsA
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mmi  Mycobacterium marinum M
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mmi00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmi00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mmi00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1865754..1866716
Genome map
AA seq 320 aa AA seqDB search
MAPTSVSNARIEKAVLDAHEKQKNKHGGKNADYIPILAQVPSTLFGVSVATVDGQVFTAG
DAGYEFALESISKIFTLALVIEQRGPRELRLKVGADPTGEAFNSVLALELHNDKPMSPLV
NAGAISTTSLVDAVGPEDRWRQIVGAQSDFAGRQISISEEINASEQATNFHNRAIAWLLR
GSGYIYCDPMEACDIYTRQCSTLVTTADLAVMGATLANGGTNPITGKRVIARKNVPHVLA
EMTMEGVYTRSGDWAYTVGLPAKSGVGGGLVAVAPGQLAIAAFSPPLDKVGNSVRAQAAV
AQIADTLQLGLFNVPGEEDE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggctcccacttcggtgtcgaacgcccggatcgagaaggcagtcctcgacgcacacgag
aagcagaagaacaagcacggcggcaagaacgccgactacattccgattctggcgcaggtg
ccctcgaccctattcggagtgtccgtcgctaccgtcgacggacaggtcttcaccgcgggt
gatgcggggtacgagttcgcgctggaatcgatctcgaagatcttcactcttgcgctggtg
atcgaacaacgcggtccccgagagctgcgcctcaaggttggcgcggacccaaccggtgag
gcgttcaactcggtgctggcgctcgagctgcacaacgacaaaccgatgtcgccgcttgtc
aatgccggcgcgatatcgacgaccagcttggtggacgccgttggtcccgaggaccgctgg
cgccagatcgtcggggcgcaaagcgatttcgcgggacgtcagatctcgatcagcgaggag
atcaacgcctccgagcaggccaccaactttcacaatcgcgccatcgcctggctgctgcgc
ggcagcggatacatctactgcgatccgatggaagcctgcgacatctacacccgccagtgc
tcgacgttggtcacgacggcggacctggctgtgatgggggcgacgctggccaacggcggg
acgaatccgatcaccggcaagcgggtgatcgcacgcaagaatgttccgcatgtgctcgcc
gagatgacgatggaaggtgtctacacccgctcgggcgactgggcctatacggtcgggttg
cccgccaagagcggcgtaggcggcgggctggtcgccgtcgcgccggggcagctggcgata
gcggccttctcgccgccgctggacaaggtgggcaacagcgttcgcgcccaagccgctgtg
gcccagatcgccgacaccctgcaactcgggctgttcaacgttcccggcgaggaagacgaa
tag

DBGET integrated database retrieval system