KEGG   Mycobacterium marinum: MMAR_1681Help
Entry
MMAR_1681         CDS       T00694                                 

Definition
transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mmi  Mycobacterium marinum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MMAR_1681
Enzymes [BR:mmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MMAR_1681
Glycosyltransferases [BR:mmi01003]
 Polysaccharide
  Storage polysaccharide
   MMAR_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2027447..2028691)
Genome map
AA seq 414 aa AA seqDB search
MKILMVSWEYPPVVIGGLGRHVHHLATALVAAGHEVVVLSRRPSGTDPSTHPSSDLISEG
VRVIAAAQDPHEFSFGSDMMAWTLAMGHAMVRAGLTLSGPGAEQPWQPDIVHAHDWLVAH
PAIALADYYDVPMVSTIHATEAGRHSGWVSGDLSRQVHAVESWLVRESDSLITCSGSMSD
EITELFGPGLAETAVIRNGIDAARWPFAVRKPRTGPPELLYVGRLEYEKGVHNAIAALPR
IRRAHPGTTLTIAGEGTQQDWLVEQARKHRVLKATKFLGHLEHAELLTLLHRADAAVFPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVIDGVTGVSCPPRDVAALAAAVCGVLDDPA
AAQQRARAARERLNSDFDWQTVAEQTAQVYLAAKRGERQPLPRLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgatggtgtcgtgggagtacccaccggtggtgatcggcgggctcggccgc
catgtccaccacctcgccaccgcattggtcgcggccggccacgaagtcgtggtgctgtcc
cgccggccctcgggcaccgaccccagcacccacccatcgtctgatctgatcagcgaggga
gtccgggtgatcgcggccgcgcaggatccgcacgaattcagcttcggtagcgacatgatg
gcttggaccctggccatgggtcacgccatggtccgggccggccttaccctcagcggtccc
ggcgcggagcaaccctggcaacccgacatcgtgcacgcgcatgactggctggtggcacat
ccggcgattgcgctcgccgactactacgacgtgccaatggtttccacgattcatgcgacc
gaagccgggcggcattccggttgggtttcgggagatctgagtcgtcaggtgcacgcggtc
gaatcctggctggtgcgtgaatccgattcgctgatcacatgttcgggatcgatgagcgat
gagatcaccgagctgttcggcccagggctggccgaaacggcggtgattcgcaacggtatc
gacgcggcgcgctggccttttgcggtccgtaaaccacgcaccgggccaccggaactgctc
tacgtcggccggctggagtacgagaagggtgtgcacaatgccattgccgcactgccgcgg
atcaggcgcgcgcacccaggcaccacacttaccatcgccggcgaaggcacccaacaggat
tggctggtcgagcaggcacgcaaacaccgggtgctcaaggccaccaagttcctgggccac
ctcgagcacgccgaactgctgaccctgctacatcgggccgacgccgcggtgttccccagc
cactacgagccgttcggactggtcgcgctggaggccgccgcggccggaacaccgttggtg
acgtcgaatatcggcgggttgggcgaagcggtgatcgacggggtcaccggggtatcgtgc
ccaccccgcgacgtggcggcgctggccgccgcggtgtgcggtgtgctcgatgatccggcc
gccgcgcagcaacgtgcccgggccgcgcgggaacggctcaactccgacttcgattggcag
accgtggccgagcagaccgcgcaggtgtacctggcggccaagcgcggagaacggcagccg
ctgccccggttgccgatcgtcgagcacgcgctgcctgatcgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system