KEGG   Mycobacterium marinum: MMAR_1703Help
Entry
MMAR_1703         CDS       T00694                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_1703 (pfkA)
   01230 Biosynthesis of amino acids
    MMAR_1703 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_1703 (pfkA)
   00030 Pentose phosphate pathway
    MMAR_1703 (pfkA)
   00051 Fructose and mannose metabolism
    MMAR_1703 (pfkA)
   00052 Galactose metabolism
    MMAR_1703 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MMAR_1703 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MMAR_1703 (pfkA)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MMAR_1703 (pfkA)
Protein phosphatases and associated proteins [BR:mmi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MMAR_1703 (pfkA)
Messenger RNA biogenesis [BR:mmi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MMAR_1703 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052031..2053062
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFQDGWRGLLENRRLQLRNDDRNDR
LLAKGGTMLGTARVHPDKLRAGLPQIKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALMVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
SGLASGAHMTLIPEQPFDIEEVCRLVKQRFQRGDSHFICVVAEGAKPVSGSMQLREGGLD
EFGHERFTGVAAQLGWEVEKRINKDVRVTVLGHVQRGGQPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggattggagttctcacgggaggcggcgactgtccagggctgaatgcggtgatccgg
gcggtggtgcgtacttgcgacgcccggtacggctcatcggtggtcggatttcaggacggc
tggcgcgggttgctggagaaccggcggctgcagttgcgcaacgacgaccgcaacgaccgg
ctgctggccaagggcggaacgatgctcggcaccgcccgcgtacaccccgacaaactgcgg
gccgggttgccccagatcaaacagacgttagacgacaacggcattgacgtgctcatcccg
atcggcggcgaaggcacgctgaccgccgcgcactggctgtccgaagagaacgttccggtg
gtcggcgtgcccaagacgatcgacaacgacatcgactgcaccgatgtgactttcggccac
gacacggccttgatggtggcaaccgaggccatcgacaggctgcacagcaccgcggaatcc
caccagcgggtgatgctggtcgaggtgatgggtaggcatgcgggctggatcgcgctgaac
tccgggctggcatctggcgcacacatgacgctcatccctgagcagcccttcgacatcgaa
gaggtgtgccgtctggtcaaacagcgcttccagcgaggcgattcgcacttcatctgtgtg
gtcgccgagggcgccaagcccgtttcgggctcgatgcagttgcgcgagggcggactcgac
gaattcggtcacgaacgattcaccggcgtcgccgctcagctcggctgggaagtggaaaag
cgcatcaacaaggatgtccgggtgaccgtgctgggccacgtgcaacggggcggacagccg
acggcctacgaccgggtgctggccacccggttcggcgtcaatgccgctgacgccgcacat
gcgggcgaatacggccagatggtgtcgctgcgcggtcaggacatcggccgtgtacccctg
gccgacgccgttcgacagctcaagctggtaccgcagagccgctacgacgacgccgctgag
ttcttcggctga

DBGET integrated database retrieval system