KEGG   Mycobacterium marinum M: MMAR_1703Help
Entry
MMAR_1703         CDS       T00694                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00010  Glycolysis / Gluconeogenesis
mmi00030  Pentose phosphate pathway
mmi00051  Fructose and mannose metabolism
mmi00052  Galactose metabolism
mmi00680  Methane metabolism
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01120  Microbial metabolism in diverse environments
mmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_1703 (pfkA)
   00030 Pentose phosphate pathway
    MMAR_1703 (pfkA)
   00051 Fructose and mannose metabolism
    MMAR_1703 (pfkA)
   00052 Galactose metabolism
    MMAR_1703 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MMAR_1703 (pfkA)
Enzymes [BR:mmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MMAR_1703 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MMAR_1703 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: ACC40152
UniProt: B2HIF8
Position
2052031..2053062
Genome map
AA seq 343 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFQDGWRGLLENRRLQLRNDDRNDR
LLAKGGTMLGTARVHPDKLRAGLPQIKQTLDDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALMVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
SGLASGAHMTLIPEQPFDIEEVCRLVKQRFQRGDSHFICVVAEGAKPVSGSMQLREGGLD
EFGHERFTGVAAQLGWEVEKRINKDVRVTVLGHVQRGGQPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcggattggagttctcacgggaggcggcgactgtccagggctgaatgcggtgatccgg
gcggtggtgcgtacttgcgacgcccggtacggctcatcggtggtcggatttcaggacggc
tggcgcgggttgctggagaaccggcggctgcagttgcgcaacgacgaccgcaacgaccgg
ctgctggccaagggcggaacgatgctcggcaccgcccgcgtacaccccgacaaactgcgg
gccgggttgccccagatcaaacagacgttagacgacaacggcattgacgtgctcatcccg
atcggcggcgaaggcacgctgaccgccgcgcactggctgtccgaagagaacgttccggtg
gtcggcgtgcccaagacgatcgacaacgacatcgactgcaccgatgtgactttcggccac
gacacggccttgatggtggcaaccgaggccatcgacaggctgcacagcaccgcggaatcc
caccagcgggtgatgctggtcgaggtgatgggtaggcatgcgggctggatcgcgctgaac
tccgggctggcatctggcgcacacatgacgctcatccctgagcagcccttcgacatcgaa
gaggtgtgccgtctggtcaaacagcgcttccagcgaggcgattcgcacttcatctgtgtg
gtcgccgagggcgccaagcccgtttcgggctcgatgcagttgcgcgagggcggactcgac
gaattcggtcacgaacgattcaccggcgtcgccgctcagctcggctgggaagtggaaaag
cgcatcaacaaggatgtccgggtgaccgtgctgggccacgtgcaacggggcggacagccg
acggcctacgaccgggtgctggccacccggttcggcgtcaatgccgctgacgccgcacat
gcgggcgaatacggccagatggtgtcgctgcgcggtcaggacatcggccgtgtacccctg
gccgacgccgttcgacagctcaagctggtaccgcagagccgctacgacgacgccgctgag
ttcttcggctga

DBGET integrated database retrieval system