KEGG   Mycobacterium marinum M: MMAR_1836Help
Entry
MMAR_1836         CDS       T00694                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00900  Terpenoid backbone biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01130  Biosynthesis of antibiotics
Module
mmi_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MMAR_1836 (dxr)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MMAR_1836 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Epimerase
Motif
Other DBs
NCBI-ProteinID: ACC40285
UniProt: B2HJP9
Position
2235392..2236600
Genome map
AA seq 402 aa AA seqDB search
MTTATDGSADGRLRVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGGSNLDTLLRQRAE
TGVTEIAIADERAAQLAGDIAYQGPDAVTRLVEETEADVVLNALVGALGLRPTLAALASG
ARLALANKESLVAGGPLVLQAAQPGQIVPVDSEHSALAQCLRAGTPDEVAKLVLTASGGP
FRGWSAADLQEVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYERIEVV
VHPQSIVHSMVTFVDGSTIAQASPPDMKLPISLALGWPRRVPGAARYCDFSQAQTWEFEP
LDDEVFPAVELARHAGETGGCMTAVYNAANEEAAAAFLAGRISFPAIVGTIADVLHAADQ
WAVSPANVDDVLDAQRWARQRAQRAIAKASPAGACEKVSGLA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgactactgccaccgacgggtccgccgacggccgcttgcgcgtgctagtgctgggcagc
acgggttcgatcggcacccaggcgctggaagtcatcgccgccaatccggaccgtttcgag
gtcgtcgggctggctgccgggggcagcaatctggacacgctgctgcgacagcgcgccgag
accggcgtaacggagattgcgatcgccgacgagcgggcggcgcaactggccggcgacatt
gcgtaccaggggcccgacgctgtcacccggctggtggaggagaccgaggccgacgtcgtc
ctcaacgcgctcgtcggcgcattgggcctgcgcccgacgctggccgcgctggcatccggg
gccaggctggccttggccaacaaggaatcgctggttgccggcggtccactggtactgcag
gccgcgcaacccggtcagatcgtgccggtcgactccgagcattccgcgctggctcagtgc
ttgcgcgcaggcacccccgacgaagtcgccaaactagtgttgaccgcctcgggtgggccg
tttcgggggtggtcggcggccgaccttcaggaggtcaccccggagcaggccggtgcccat
ccgacctggtcaatgggcccgatgaatacgctgaactcggcctcactggtcaacaaggga
ctcgagctcatcgaaacccacctactgttcggcatcccgtacgagcgcatcgaggtcgtc
gtgcatccgcagtcgatcgtgcattccatggtcaccttcgtcgacggttcgaccatcgcc
caggccagccccccggacatgaaattgccgatctcgctggcgttgggctggccgcgccgg
gtgccgggtgcggcccgttattgcgatttcagtcaggctcagacgtgggagttcgagccg
ctggacgacgaggtgtttcccgccgtcgagctggctcgccatgccggcgagaccggcggg
tgcatgaccgcggtgtacaacgcggccaacgaagaagcggcagcggccttcctcgccggc
cggatcagtttccccgccatcgtgggaactatcgccgacgtgctgcacgctgccgaccaa
tgggccgtttcacccgctaacgtggatgacgtacttgacgcgcagcgttgggcgcggcag
cgggcacagcgtgcgatcgccaaagcaagcccggccggcgcatgcgagaaggtctccgga
ctggcttga

DBGET integrated database retrieval system