KEGG   Mycobacterium marinum M: MMAR_1883Help
Entry
MMAR_1883         CDS       T00694                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mmi  Mycobacterium marinum M
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2294873..2296723
Genome map
AA seq 616 aa AA seqDB search
MKAYPFSAIVGHDQMRLALLLCAVRPEIGGVLIRGEKGTAKSTAVRGLAALLSAATGSSG
PGLVEMPLGATEDRVVGSLDLQRVLRDGEHAFAPGLLARAHGGVLYVDEVNLLHDHLVDI
LLDAAAMGRVHVERDGISHSHEARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVDV
RVEVIRQRMAFEADPDAFCERYVGPDAELARRIAEARDIVDTVVLPDHELRRIAALCAAF
DVDGMRADLVLARTATAHAAWRGAPAVEEQDVRVAAELALPHRRRRDPFDDHGIDRDQLD
EALARAGAESQGSPEPEPDPPGGGQSAGQDCPPQQQNSNSRPQQAPKPSAGPSKVFRTRA
LVVPGVGEGAPGRRSRARNGSGSVVAAADGSDSNSGARGLHLFATLLSAAENATGSGPLR
PQGADIRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATMSLLRDAYQRRDKVAVIT
FRQHEAKILLSPTSSAHIASRRLARFDTGGKTPLAEGLLAARELVIREKVRDRARRPLVV
VLTDGRATAGPDPLGRSRIAAARLVAEGATAVVVDCETSYVRLGLAQQLARHLGAPAVRL
EQLHADYLAQAIRSVA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctatccattcagcgcgatcgttggacacgaccagatgcgactggcgttgctg
ttgtgcgccgttcgtccggagataggcggcgtgctcattcgcggcgagaagggcaccgcg
aaatcaacagccgtgcgcgggctcgccgcgctactgtccgccgctaccggcagttccggt
cccgggctggtcgaaatgccgctgggagccaccgaggaccgggtggtcggctcgctggac
ctgcagcgcgtcttgcgcgatggcgaacacgccttcgcaccgggactgctggcccgcgcc
cacgggggagtgctctacgtcgacgaagtgaacttgctgcacgatcatctggtcgacatc
ttgctcgacgccgccgcgatggggcgggtgcacgtcgaacgggacggcatctcacattcg
cacgaggcccgcttcgtcctgatcggcacgatgaatcccgaagaaggcgaactgcgtcca
caactgctggaccggttcgggctgaccgtcgacgtgcacgcgtcccgcgatgtggacgtc
cgggtggaagtcattcgccagcggatggcttttgaagccgacccggacgccttctgtgaa
cgctatgtcggccccgacgccgagctggcccgccgtatcgccgaggcgcgggacatcgtc
gacacggtcgtgttgcccgaccacgaattgcgccggatcgccgcgttgtgcgcggcgttc
gacgtcgatggcatgcgagcggatctggtgctggcccgaacggccaccgctcatgcggcg
tggcgcggcgcaccggccgtcgaagaacaagacgtgcgggtcgccgcggaactggcattg
ccccatcgccgtcgtcgggacccattcgacgatcacggtattgaccgcgaccagctcgac
gaggcactggcacgggccggagcggagtcgcagggttcgcccgagccggagcccgacccg
ccgggtggaggccagtcagccggccaggattgccctccccaacaacagaactcgaactcc
aggccccagcaggcgcccaagcccagcgccgggccgtccaaggtgttccgcacccgcgcg
ctggttgtgcccggggtcggcgaaggtgcgcccgggcggcgctcgcgggcgcgcaacggc
tccggcagcgtggtagcggccgccgacggtagtgacagcaattccggcgcccgtgggttg
cacctgttcgccaccttgctctcggccgccgaaaacgccaccggatcggggccgctgcgc
ccgcagggcgccgacatccgccgggcggtgcgcgaggggcgtgagggcaacctggtgatc
ttcgtcgtggacgcttcgggatcgatggctgcccgggatcggatggcggcggtcagcggc
gcgaccatgtcgctgctgcgcgatgcctaccagcgccgggacaaggtcgcggtgatcacg
ttccgccagcatgaagccaagatcctgctgtcacccacctcgtcggcgcacatcgccagc
cggcggctggcccggttcgacaccggcggcaagactccgctggccgagggtctgctggcc
gcgcgcgagctggtgatccgggagaaagtacgcgaccgcgcccgccgcccgctggtggtg
gtgctcaccgatggacgggccaccgccgggccggacccgttgggccgcagccgaatcgcc
gccgctcggcttgtcgccgaaggcgccaccgcggtggttgtggactgcgagacgtcgtat
gtgcggctcggactggcccagcaactcgcccgccatctcggcgcgccggcggtgcggctc
gaacagttgcacgccgactacttggcgcaagccatccgcagcgtggcctga

DBGET integrated database retrieval system