KEGG   Mycobacterium marinum: MMAR_2039Help
Entry
MMAR_2039         CDS       T00694                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mmi  Mycobacterium marinum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MMAR_2039 (hemY)
Enzymes [BR:mmi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MMAR_2039 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460530..2461897
Genome map
AA seq 455 aa AA seqDB search
MTPGSYCVVGGGISGLTAAFRLRLAVGEDALITLLDPSDRLGGILRTERVGGQPMDLGAE
AFVVRRPEMPALLAELGLSGLQRSTTGARPLIYSCQELHPLPTGTVMGIPASARSLAGLV
DDATIAQIEAEPDRPLHWRPGGDPAVAELVAERFGEQTVTRSVDPLLCGVYAGSAATIGV
RAAIPAVAAALDRGATSLTEAVRQSLPPASVGPVFGALTGGYQVLVEELVARSGVQWVQA
AVSKIEPGWALHDDAGRRWHADAVILAIPAPRLVRILDGVDGVDPRSVAAASRVRSASSA
VVALAVPADTPFPQCSGVLVANGEPLRAKAITLSSRKWGIQGDVQQLRISFGRFGDDLAE
RVSDHQLLSWARDDLATVFGVTVDPVDSRVQRWIEAMPQYGPGHGELVAQVRAGLPPTLA
VAGSYLDGIGVPACVGAASRAVDGIVGALNPQVAR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgggctcgtattgtgttgtgggcggtggaatctcgggcctgaccgcggccttc
cggttgcggctggcggtcggtgaagacgccttgatcaccctgttggaccccagcgatcgg
ctgggcggaatcttgcgcaccgagcgggtcggcggacagccgatggatctgggtgccgaa
gcgttcgtggtgcgccgtccggagatgcccgccctgctcgccgaactcggtctgtccggg
ctgcagcgctccaccaccggcgcccggccgctgatctacagctgccaagagctgcacccg
ctgccaacgggcaccgtgatggggatcccggcttcggcgcgctcgcttgccggcctggtt
gacgacgccacgattgcccagatcgaggccgaaccggaccggccgctgcactggcgcccg
ggcggcgatcccgcggtggccgaactggtggccgagcggttcggcgagcagaccgtgacc
aggtcggtcgatccgctgctgtgcggcgtctatgcgggctcggccgccacgatcggtgtg
cgcgcggccatcccggcggtggcggcggcgctggaccgcggcgccaccagcctgaccgag
gcggttcggcagagcttgccaccggccagtgtcggtccggtgttcggtgccttgacgggc
ggctatcaggtgctggtcgaggagctggtcgcacgcagtggggtgcagtgggtgcaggcc
gcggtcagcaagatcgaacccggttgggcactgcacgacgatgccggccggcgctggcac
gccgacgccgtcatcctggccatcccggccccgcgcctggtgcggatcctcgacggtgtc
gacggggtggatccgcgcagcgtcgcggccgcgagccgggtgcgcagtgcctcctcggct
gtggtggcgctggcggtgccggcagatacccccttcccgcagtgttcgggggtgctggtg
gccaacggtgagccgttgcgggccaaggcaatcacgttgtcgtcgcggaaatggggtatc
cagggcgacgtccagcagctgcggatttcgttcgggcggttcggcgacgacctggccgag
cgcgtgtccgaccaccagctgctttcgtgggcgcgcgacgacctggccacggtgttcggt
gtgacggtggatcccgtcgattcacgtgtgcagcggtggatcgaggcgatgccgcaatac
ggtccgggtcacggggagctggtcgcgcaggtgcgggccgggctgcccccgacattggcc
gtggccggcagctatctggacggaatcggggtgccggcctgtgtcggggcggcaagccgc
gcggtggacggcatcgttggggcgctcaacccgcaagtggcacgatag

DBGET integrated database retrieval system