KEGG   Mycobacterium marinum: MMAR_2153Help
Entry
MMAR_2153         CDS       T00694                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmi  Mycobacterium marinum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MMAR_2153
Enzymes [BR:mmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MMAR_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2594503..2595288
Genome map
AA seq 261 aa AA seqDB search
MATTFSDSKSELMRRAQERLDAQTPESQLTTRQKVALTCRVLFDAGHDSGLAGQITARAQ
RPGTYYTQQLGLGFDEITEDNLLLVDEDLNVLEGSAMANPANRFHSWIYRERPDVQCIVH
THGFHTAALSMLKVPLIVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIISAALGNKKAIL
LAHHGQLIAGISIEEACTLAVLIERAAKLQLAAMSAGTIAELPDQLAREAHDWTLTPSRS
RANFAYYARRALARHPDALSS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccactttctccgattccaagtccgagttgatgcgacgggcccaggaacgcctc
gatgcccagacgcccgaatctcagctgaccacccggcaaaaggtcgcgttgacctgccgg
gtgttgttcgacgccggccacgattccggtctggccgggcagatcaccgcgcgtgcgcag
cggcccggcacctattacacccaacaactcggcttgggattcgacgagatcaccgaagac
aacttgctgttggtcgacgaggacctcaatgttctcgagggctccgcgatggccaacccg
gcaaatcgatttcacagctggatctaccgcgaacggccggacgtgcagtgcatcgttcat
acccatgggttccacaccgcggcgttgtcgatgctgaaggtgccgttgatcgtttcgcac
atggacaccacgccgctctatgacgactgcgctttcctcgccgactggccaggcgtgccg
gtgggtaacgaggaaggcgagatcatcagcgccgcattgggaaacaagaaggcgatcctt
cttgcgcaccacgggcagttgatagccggcatcagcatcgaggaggcctgcacgctggcg
gtcctgatcgaacgcgccgccaaactgcaactggcggccatgagtgcgggaacaatcgcc
gaactaccggaccaactggcccgcgaggctcacgattggaccctgacaccttcccgcagc
cgggcgaactttgcctactacgcgcgtcgcgcactggcccgtcaccccgatgcgctgagc
agctga

DBGET integrated database retrieval system