KEGG   Mycobacterium marinum M: MMAR_2153Help
Entry
MMAR_2153         CDS       T00694                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmi  Mycobacterium marinum M
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2594503..2595288
Genome map
AA seq 261 aa AA seqDB search
MATTFSDSKSELMRRAQERLDAQTPESQLTTRQKVALTCRVLFDAGHDSGLAGQITARAQ
RPGTYYTQQLGLGFDEITEDNLLLVDEDLNVLEGSAMANPANRFHSWIYRERPDVQCIVH
THGFHTAALSMLKVPLIVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIISAALGNKKAIL
LAHHGQLIAGISIEEACTLAVLIERAAKLQLAAMSAGTIAELPDQLAREAHDWTLTPSRS
RANFAYYARRALARHPDALSS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccactttctccgattccaagtccgagttgatgcgacgggcccaggaacgcctc
gatgcccagacgcccgaatctcagctgaccacccggcaaaaggtcgcgttgacctgccgg
gtgttgttcgacgccggccacgattccggtctggccgggcagatcaccgcgcgtgcgcag
cggcccggcacctattacacccaacaactcggcttgggattcgacgagatcaccgaagac
aacttgctgttggtcgacgaggacctcaatgttctcgagggctccgcgatggccaacccg
gcaaatcgatttcacagctggatctaccgcgaacggccggacgtgcagtgcatcgttcat
acccatgggttccacaccgcggcgttgtcgatgctgaaggtgccgttgatcgtttcgcac
atggacaccacgccgctctatgacgactgcgctttcctcgccgactggccaggcgtgccg
gtgggtaacgaggaaggcgagatcatcagcgccgcattgggaaacaagaaggcgatcctt
cttgcgcaccacgggcagttgatagccggcatcagcatcgaggaggcctgcacgctggcg
gtcctgatcgaacgcgccgccaaactgcaactggcggccatgagtgcgggaacaatcgcc
gaactaccggaccaactggcccgcgaggctcacgattggaccctgacaccttcccgcagc
cgggcgaactttgcctactacgcgcgtcgcgcactggcccgtcaccccgatgcgctgagc
agctga

DBGET integrated database retrieval system