KEGG   Mycobacterium marinum: MMAR_2241Help
Entry
MMAR_2241         CDS       T00694                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmi  Mycobacterium marinum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MMAR_2241 (tpiA)
   01230 Biosynthesis of amino acids
    MMAR_2241 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMAR_2241 (tpiA)
   00051 Fructose and mannose metabolism
    MMAR_2241 (tpiA)
   00562 Inositol phosphate metabolism
    MMAR_2241 (tpiA)
Enzymes [BR:mmi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MMAR_2241 (tpiA)
Exosome [BR:mmi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MMAR_2241 (tpiA)
  Exosomal proteins of bladder cancer cells
   MMAR_2241 (tpiA)
  Exosomal proteins of melanoma cells
   MMAR_2241 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2694876..2695661
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYYDKVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDSGAYTGDISGAFLAKLGCSFVVVGHSERRTYHNEDDALVAAKAAA
ALKHDLTPIVCIGEHLDVREAGNHVAHNVEQLRGSLSGLSAEQISKVVIAYEPVWAIGTG
RVAGAADAQEVCAAIRSELGSLASPQIADAVRVLYGGSVNAKNIGELIAQADVDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgttgatcgccggcaactggaagatgaacctcaatcacttcgaggcg
atcgctctggtgcagaagatcgcattctcgttgccggacaagtactacgacaaagtcgat
gtgacggtcattccgccgttcaccgacttgcgcagtgtgcagaccttggtcgacggtgac
aagctgcgcctgacctatggcggtcaagacctgtcccagcacgactccggtgcctatacc
ggtgacatcagtggggcatttctggccaaactgggctgcagcttcgtcgtcgtggggcat
tcggaacggcgcacctaccacaacgaggacgacgctctagtggccgccaaggctgccgcg
gcgctcaagcacgacctgactccgatcgtctgcatcggcgagcacctcgatgtgcgtgag
gcgggaaatcacgtggcgcacaacgtcgaacaactgcgcggttcgctgtccgggctgtca
gcagagcagatcagcaaggtggtcatcgcctacgagccggtctgggcgatcggcaccggg
cgggtagccggcgcagccgacgcccaggaagtctgtgcggcaatccgcagcgagcttggt
tcgctggcctcgccgcagatcgccgacgcggttcgggtgctctacggcggctcggtcaac
gcgaagaacatcggcgaactgatcgcgcaggcggacgtcgacggtggcctggtgggtggc
gcgtcgttggacggtgaacagtttgcgacgctggcggccatcgccgccgggggaccgctg
ccgtaa

DBGET integrated database retrieval system