KEGG   Mycobacterium marinum M: MMAR_2413Help
Entry
MMAR_2413         CDS       T00694                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01130  Biosynthesis of antibiotics
mmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMAR_2413 (trpC)
Enzymes [BR:mmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MMAR_2413 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACC40863
UniProt: B2HQX7
Position
2911999..2912817
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREALVGMTEIKAAAAAAPPPLDVMAALRQPGIGVIAEVKR
ASPSAGSLAPITDPAKLARAYEDGGARIISVLTEGRRFQGSLDDLDAVRAAVSIPLLRKD
FVVQPYQIHEARAHGADMLLLIVAALDQSALVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLTTLEVDRDCFARIAPGLPSNVIRIAESGVRGTNDLLAYAGAGADAVL
VGEGLVKSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaacagtgcttgactccattctcgagggagtccgggccgacgttgccgcg
cgcgaggcgcttgtcggcatgaccgagatcaaggccgccgccgcggcggcgccgccgcca
ctggacgtgatggccgccctgcgtcagccgggtattggtgtcatcgccgaggtgaagcgt
gccagcccatctgctggctcgttggcgcccatcaccgaccccgccaagctggcgcgtgcc
tatgaggatggcggcgcgcgcatcatcagtgtgttgaccgagggccggcgttttcagggt
tcgctcgacgatctcgatgcggtgcgcgcggcagtctctattccgttattgcgcaaagac
tttgtggttcagccctatcagatccatgaggcgcgggcgcacggtgcggacatgctgctg
ctcattgtcgccgcgttggaccagtcagcgctggtgtccatgctggaccgaaccgaatcg
ctggggatgaccgcgcttgtcgaggtgcacaccgagcaggaggcggaccgggcattgaag
gctggggccaaggtcatcggcgtcaatgcgcgcgatctcaccaccttggaggtggaccgg
gactgcttcgcgcgaatcgctccgggattacccagcaacgtgatcaggattgccgagtcc
ggcgtgcgcggcaccaatgatctgctggcgtatgccggtgctggcgcagacgccgtgttg
gtcggcgaagggctggtcaagagtggtgacccacgggcggcggttgctgatctggtcacc
gcaggcacccatccgtcctgcccaaaaccagcccgctaa

DBGET integrated database retrieval system