KEGG   Mycobacterium marinum M: MMAR_2414Help
Entry
MMAR_2414         CDS       T00694                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmi  Mycobacterium marinum M
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mmi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mmi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2912853..2914130
Genome map
AA seq 425 aa AA seqDB search
MADLSRPDLPRTSSAIAERTSHDPDSGGHFGAYGGRYVPEALMAVIEEVTVAYEKERVNQ
DFLDTLDRLQTHYAGRPSPLYEATRLSEHAGSARIFLKREDLNHTGSHKINNVLGQALLA
RRMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGAEVVA
VETGSKTLKDAINEAFRDWVTNADRTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQG
QAGKLPDAVVACVGGGSNAIGIFHAFLDDPDVRLVGFEAAGDGVETGRHAATFAGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKDIGRVTYQPITDSEAMEAFGL
LCRMEGIIPAIESAHAVAGALKLGRELGKGAVIVVNLSGRGDKDVETAAKWFGLLTPGGS
ANKSV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctatctcgcccggacctgccgcggaccagttccgcgattgcagaacggacc
tcccacgatcccgattcaggcgggcatttcggcgcctacggtggccgttacgtcccagag
gcgctcatggcggtgatcgaagaggtcaccgtcgcgtacgagaaagagcgggtaaaccag
gacttcctggacacgctcgatcggctgcaaacgcactacgccggtcggccgtcgccgctg
tacgaagccaccaggctcagcgagcacgctggctcagctcgaatcttcctgaagcgagaa
gacctaaaccacaccggctctcacaaaatcaacaatgtgctcggtcaggcattgctggcc
cgccggatggggaagacccgggtgatcgccgagaccggcgccggacagcatggtgtggct
acggccaccgcgtgtgcgctgctgggcctggaatgtgtcatctacatgggggccgttgac
accgcgcgtcaggcgctcaacgtagccaggatgcggctgctcggcgctgaggtcgtcgcc
gtggaaaccggttcaaaaaccctcaaagacgccatcaatgaggcattccgggattgggtc
accaacgccgatcgcacctactactgctttggtaccgcggctgggccccatcccttcccg
accatggttcgcgattttcagcggatcatcggcatggaggctcgtgtgcagatccaaggt
caggcgggcaagctgcctgatgcggtcgtggcatgcgtcggtggaggatccaatgcaatc
gggatctttcatgcatttctcgacgatcccgatgttcgattggtgggatttgaggcggca
ggcgacggcgtcgagacgggtcggcacgcggcgacgtttgccggtggttcgcccggagca
ttccagggctccttctcctacttgctgcaggacgaagacggtcaaaccatcgaatcccat
tcgatctcagcgggtctggactatcccggggtcggccccgaacatgcctggctcaaggac
atcgggcgcgtcacttaccagccgattaccgattccgaggcgatggaggcattcggcctg
ctatgccggatggaaggcatcatccccgccatcgaatccgcccatgcggtggccggtgct
ctcaagctgggtcgtgagctgggaaagggtgcggtgattgtggtgaatttgtcggggcgg
ggcgacaaggatgtcgaaacggctgccaaatggttcggtctgctgacgcctggcggcagc
gcgaacaagtcggtttga

DBGET integrated database retrieval system