KEGG   Mycobacterium marinum: MMAR_2414Help
Entry
MMAR_2414         CDS       T00694                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmi  Mycobacterium marinum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MMAR_2414 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMAR_2414 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMAR_2414 (trpB)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MMAR_2414 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2912853..2914130
Genome map
AA seq 425 aa AA seqDB search
MADLSRPDLPRTSSAIAERTSHDPDSGGHFGAYGGRYVPEALMAVIEEVTVAYEKERVNQ
DFLDTLDRLQTHYAGRPSPLYEATRLSEHAGSARIFLKREDLNHTGSHKINNVLGQALLA
RRMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGAEVVA
VETGSKTLKDAINEAFRDWVTNADRTYYCFGTAAGPHPFPTMVRDFQRIIGMEARVQIQG
QAGKLPDAVVACVGGGSNAIGIFHAFLDDPDVRLVGFEAAGDGVETGRHAATFAGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKDIGRVTYQPITDSEAMEAFGL
LCRMEGIIPAIESAHAVAGALKLGRELGKGAVIVVNLSGRGDKDVETAAKWFGLLTPGGS
ANKSV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctatctcgcccggacctgccgcggaccagttccgcgattgcagaacggacc
tcccacgatcccgattcaggcgggcatttcggcgcctacggtggccgttacgtcccagag
gcgctcatggcggtgatcgaagaggtcaccgtcgcgtacgagaaagagcgggtaaaccag
gacttcctggacacgctcgatcggctgcaaacgcactacgccggtcggccgtcgccgctg
tacgaagccaccaggctcagcgagcacgctggctcagctcgaatcttcctgaagcgagaa
gacctaaaccacaccggctctcacaaaatcaacaatgtgctcggtcaggcattgctggcc
cgccggatggggaagacccgggtgatcgccgagaccggcgccggacagcatggtgtggct
acggccaccgcgtgtgcgctgctgggcctggaatgtgtcatctacatgggggccgttgac
accgcgcgtcaggcgctcaacgtagccaggatgcggctgctcggcgctgaggtcgtcgcc
gtggaaaccggttcaaaaaccctcaaagacgccatcaatgaggcattccgggattgggtc
accaacgccgatcgcacctactactgctttggtaccgcggctgggccccatcccttcccg
accatggttcgcgattttcagcggatcatcggcatggaggctcgtgtgcagatccaaggt
caggcgggcaagctgcctgatgcggtcgtggcatgcgtcggtggaggatccaatgcaatc
gggatctttcatgcatttctcgacgatcccgatgttcgattggtgggatttgaggcggca
ggcgacggcgtcgagacgggtcggcacgcggcgacgtttgccggtggttcgcccggagca
ttccagggctccttctcctacttgctgcaggacgaagacggtcaaaccatcgaatcccat
tcgatctcagcgggtctggactatcccggggtcggccccgaacatgcctggctcaaggac
atcgggcgcgtcacttaccagccgattaccgattccgaggcgatggaggcattcggcctg
ctatgccggatggaaggcatcatccccgccatcgaatccgcccatgcggtggccggtgct
ctcaagctgggtcgtgagctgggaaagggtgcggtgattgtggtgaatttgtcggggcgg
ggcgacaaggatgtcgaaacggctgccaaatggttcggtctgctgacgcctggcggcagc
gcgaacaagtcggtttga

DBGET integrated database retrieval system