KEGG   Mycobacterium marinum M: MMAR_2415Help
Entry
MMAR_2415         CDS       T00694                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmi  Mycobacterium marinum M
Pathway
mmi00260  Glycine, serine and threonine metabolism
mmi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmi01100  Metabolic pathways
mmi01110  Biosynthesis of secondary metabolites
mmi01130  Biosynthesis of antibiotics
mmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MMAR_2415 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MMAR_2415 (trpA)
Enzymes [BR:mmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MMAR_2415 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ACC40865
UniProt: B2HQX9
Position
2914133..2914942
Genome map
AA seq 269 aa AA seqDB search
MTVEQREASRLGPLFDSCRAENRAALIGYLPTGYPDVNTSVRAMTELVESGCDIVEVGVP
YSDPGMDGPTIQRATEAALSGGVRVRDALTAVESISKAGGRAVVMTYWNPVLRYGVDAFA
RDLAAAGGHGLITPDLIPDEAQQWLAASDEHGLDRIFLVAPSSTPERLANTVAASRGFVY
AASTMGVTGARDAVSNAAPDLVARVKAVSDIPVGVGLGVRSREQAAEIGRYADGVIVGSA
LVSALGDGLPSLRSLTEELAAGVRQRNSP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgaacaacgcgaagccagcaggctgggaccgcttttcgattcgtgccgcgca
gaaaatcgcgcggcgttgatcggatatctgcccaccggttaccccgacgtgaacacatcg
gtgcgagcgatgactgagctcgtcgaatcaggttgcgacatagtcgaagtcggcgttccc
tactcggatccgggcatggatggcccgactatccagcgggctaccgaggcggcgctgagc
gggggagtgcgagtccgggacgcgttgaccgcggtcgaatcgataagcaaggccggcggg
cgtgccgttgtgatgacgtactggaacccggtgctgcggtacggggtcgatgcattcgca
cgggatctggcggccgccggcgggcacgggctgattactcccgacctcatccccgacgag
gcccaacagtggcttgccgcctccgatgaacacgggctggaccgcatctttctggtggcg
ccgtcgtcaacacccgaacgcctggccaacaccgtcgcggcgtcacgcgggtttgtatat
gccgcgtcgaccatgggggtgaccggcgcgcgcgacgctgtgtcgaacgctgcgcccgat
ctggtggcgagggtcaaggcggtgtctgacatacccgtcggtgttggtttgggggtgcgg
tcgcgggaacaggccgccgagatcggccgctacgccgacggtgtcatcgtgggatcggcg
ttggtatcggcgttgggcgacggattgccgagtttgcgctcactgacggaggaacttgcc
gctggcgttcgccagaggaactcgccatga

DBGET integrated database retrieval system