KEGG   Mycobacterium marinum M: MMAR_2462Help
Entry
MMAR_2462         CDS       T00694                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mmi  Mycobacterium marinum M
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mmi01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmi00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2983451..2984503
Genome map
AA seq 350 aa AA seqDB search
MAHATDAIRVAVAGASGYAGGEILRLLLGHPAYTSGRLTIGAVTAAASAGSVLAEHHPHL
LPLAQRILEPTELEVLRGHDVVFLALPHGHSAALADQLGPETLIIDCGADFRLTDAAAWE
RFYGSAHSGSWPYGLPELPGARERLRDTRRIAVPGCYPTAALLALLPAVAEGLIDPAVTV
VAVSGTSGAGRAAKTDLLGSEVIGSARAYNIAGAHRHTPEIAQGLRAVTDRDVTVSFTPV
LIPTSRGILATCTARTRSPIARLRSAYEKAYEAEPFIYLMPEGQLPRTGAVIGSNAAHIA
VAVDEEAETFVAIAAIDNLVKGTAGAAVQSMNLALGWPETEGLSVVGVAP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgcgaccgatgcaatcagggtggccgtagcaggtgccagcggctatgcaggc
ggtgagatccttcgccttctgctggggcatcccgcctacacctcgggacggctgacgatc
ggggcggtgaccgcagcggccagcgcgggaagcgtcctcgcggagcaccatccgcatctg
ttgccgctggcccagcggatcctcgagcccaccgagctcgaggtgctccgcggacatgac
gtggtattcctcgctttgccgcacgggcattcggcggcgctggccgatcaactcggccca
gaaactctgatcatcgactgtggggccgattttcggctcaccgatgcggcggcttgggag
cggttctatgggtcagcgcattccggcagctggccctacggactacccgaattgccgggt
gctcgggagcggttgcgtgacacccgccgcatagcggttccgggttgctacccgaccgcg
gcgctgctcgcactgctgcccgcggtggccgagggcctcatcgatccggccgtgacggtg
gtcgccgttagcggtacctcgggggctggccgggccgccaagaccgacctgctcggctcg
gaagtcatcgggtcggcccgggcctacaacatcgcgggtgcgcaccggcatactcccgag
atcgcacaaggcttgcgcgcggtcaccgaccgagacgtcaccgtttcgtttacaccggtt
cttatcccgacctcacgtggaattctggcaacctgtaccgcgcgtacccgctcgccaatc
gctcggttacggtcagcctacgaaaaagcttatgaggcagaaccttttatctatttgatg
ccggagggtcagttgccccgcactggtgccgtgattggcagcaacgcggcgcacatagcg
gtcgctgtggatgaagaagccgagacctttgttgcgattgccgcaatcgacaacctggtc
aagggcactgccggggccgccgtgcagtcgatgaacctggcgctgggctggccggagaca
gaagggctctcagtggtcggggtggcgccatga

DBGET integrated database retrieval system